SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LbrM33_V2.1850 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  psu|LbrM33_V2.1850
Domain Number - Region: 30-75,207-245,336-388
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000787
Family WD40-repeat 0.03
Further Details:      
 
Domain Number - Region: 439-527
Classification Level Classification E-value
Superfamily SIS domain 0.00978
Family mono-SIS domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM33_V2.1850
Sequence length 591
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr33:710632-712407(+) | length=591
Sequence
MTAQTAPEAGKKKAAATVLAPAAPSPPFDFHTVTCVTWSASGRNIGVGTTDGFLIYSTEP
LVSNLSGTSTSQSTLDRSAEAAGLLAADVHNPMLQEVCRCAVYGGVGLLNLYKQCSLVAF
TGVQRRSAAARIQLADTSVQPPSDFYAPSAPPPSAGVAPATPPVPRCKPWPPEEDAAAAQ
WYERWRVSVFASSSAATATTVSTLAFVVCPPTVVGLNFCPHAVIAVASGDPKIVGSHTLH
VFDHHLHPLYTLSVYPPSSNAYLKDMVAIAATPTLSNGAGMIVQRLRVLLPGEKRGEVRL
LTFKKSALTAASFEEAAHDDYTNHPGSAYRQGYGDTHRLVDKVLHQAPLRAVAITEDGKS
GVTMSEQGMRIRVLDFVGDDKMINRLTLDRGHLPAVVDTVSLAIVSVPQAQPLMQNAATA
TAYTHERCGSNDNNAPVHVSETLSRQYQRLTEVVHDIVVCLTSSGTTHIFGCGLQQVLFY
HSDKTLLPRVGYPYAFSVCLPPLLAKEGVVSIFVARSDASTSAVHYLPRHEHCNAKGGRD
DCSNSATHHLPGEFFAFQLRYHSSSAATAATGGAGSTSKCTTLVRFTLSSP
Download sequence
Identical sequences psu|LbrM33_V2.1850 gi|154344018|ref|XP_001567953.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]