SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LbrM35_V2.4390 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM35_V2.4390
Domain Number 1 Region: 153-194
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000499
Family Transcriptional factor domain 0.0092
Further Details:      
 
Weak hits

Sequence:  psu|LbrM35_V2.4390
Domain Number - Region: 31-65
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0476
Family Putative zinc binding domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM35_V2.4390
Sequence length 195
Comment | organism=Leishmania_braziliensis | product=transcription factor S-II-like protein | location=Lbr.chr35:1594968-1595555(+) | length=195
Sequence
MSAASSQAKVRTPTEQRQVHYISDNVYTLGTLSCAVCGQAFPIHTNAWQRSTCDWCGTLH
EPGTYSAFQQHLRTSRGTSGGIQTSNKVCSLDTSAALFFTEKEVGAAVEHIRQTLGDTAG
AGGSSFFGAAPGSTGGVTRAGVTEVDNRIIEESFCETCGIHRSCKTFARQTRSADEGQTI
FFQCTECGSEWQQNS
Download sequence
Identical sequences A4HPT3
psu|LbrM35_V2.4390 XP_001569058.1.15230 gi|154346242|ref|XP_001569058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]