SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LbrM07_V2.0120 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM07_V2.0120
Domain Number 1 Region: 631-672,700-855
Classification Level Classification E-value
Superfamily Sec7 domain 7.98e-41
Family Sec7 domain 0.00022
Further Details:      
 
Domain Number 2 Region: 367-485,650-725,945-1041,1230-1365,1416-1461,1516-1528,1556-1597
Classification Level Classification E-value
Superfamily ARM repeat 0.000000144
Family Plakophilin 1 helical region 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM07_V2.0120
Sequence length 2058
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=Lbr.chr7:40363-46539(+) | length=2058
Sequence
MAASPSTGEGEAISVVTPSAADDPALAPSSTAALGGPSSSTADVTATHELADGRNLVDLV
SYLRLLFDSDVPERAKLQAFGKSLVRLLMVRCCSTIIASLQHVVHHTYAGTTTAEEDDAG
AALSALFVQLAKEIDVATRALLGCVQLVTASAVSSDAASTRFPVQLCVDVVKQTRRAQAY
LQSRVEREELRQLRAFVMSSGSAARWVEESLEDVDAAQGTIEGKSRDHIAAHVQRRVEVL
RQQWGPSLVHSVGNIGDVIEPSVKFLASVAAVRAEGAPAPLVALKKDAAQDLFSLCEPLT
TAAATGGQAGLSKSLSTDNLAAVEETPVSGSSGTPLTWRAAAGEVLTHLGSSFSADYLAA
VAGCCGDSNEGQLLATRLLTDMLQRVAAHDLPLLQCVLQNSRWYRALYNGILNCVASIQP
AVLAAGLDALRLLTTTCPEEVGQEVGFLYSNVVLRLLESPNSPHYVKRTIVLHFITTFMG
NSSTLSAGGSRSAIPLTLHMYRLYDLNVHAHQLNFIQQLTSALSRIVRAAPKEEFTQDAV
VQEQLRLQQEAAVALASAVTTQLDRTQHRPGVVNGTTPSESFSSPGAALNLASLSLPAMA
LHGLVRIVELLMTQTPPEEESGRDVLAELPVMTCRESKLKEQQEVDRFNDSPKKAIYKLF
SVSAEENAIPDSHADFSSQWEHTLLPPLPSAASAQKVEAVADFLTQISSLNPEAVAEFLT
TPEVFPLHVCAAYLRRLPLAGCSVLEAISELLMRVHLPKEGQRIERLLEYFSAAYYEANR
GHGINTDVFPFKSDTAVFIVVVATVMLNTNIHNPSAGMRLDVKAFRGQLHRCNEDESFAD
NFVDDIFYRISRRPLESIKRIAIDATASTEGASRGSFDIFFVSQEEKRQLAFGVEQQRMV
SETRQLLKLRTQQDPPAPAPDGWWYAVAKDFLLSIWSSVCAVFGPAMYEGATSAPSDVLL
QCVRGLQSLLCTAAAFDLPTECTVTLLTLLRMADATPVRAHCLRAVLAVAATTYAINFPV
RCWVAVYQLILEVRCTAAGTAPPLTEDVFTRIEAITRLSVEAEGRRAADASLPKTDRPTE
AIHRAIEGIMTTISGYAVGDVANLSSALAVLRRVLEYTRIVHLKRTADVVYFVNVRDFTA
VVVPAYVGLMQKHSSSDDGLQVLCESLVDLLCTMWASYSTCRVTVSAPATETGKAETTAT
LTVDTAPAGFVQSFRCLRSIYEVTLASASDGSATLLQMHILQAVKEVLSRTVRAAEVTSA
DQHLSLYTMMASWQEVLYPLAMALCDRSSTAIEAGSLALLVLRKLVALCGGTGTASSDQL
PGLVRATLLWLLAQLAYMGGMCGDTDSAQVCVALLSSICTSTVAMSATAVSSSSPGSSPG
GPASPVIAVEDPSTFARRMEQRNALTQQVVASIEENPHYVVHSTLARLCLLLRCEREQTR
AEVVRQLRTLSLQLRPAQLCPMVLDLAEVVLEGTIGYAAHHHTTPITHSSLTPFLFFELP
VPASLRRCFRTSFRTTVPSVLGFLANELLTGLSGDDLATAAESVMRRCLLPIFLSPNSSY
QCRFLAVRSLSQCVAVCLPQNNEAPLPKLAQCVLDCLAMALYAVRVPLTAVMSPDSSFVG
RRWLDQPTTSAGSGWAVYCAQAAYTMELMDRAEPPWLMRGAAAEAALSTFGPLPTEELNG
VAATQTASRSDCAASEEARRTGGTALFSDDLLIEYVNLLAQVLAGVPKELQGVVSSAATA
TGSTAPSASAAEVAGASTDDWELPRASAMVLLQLSLQAAGTLFAVLWRINHPHEVEQYAL
QSVEMRREAQALTRNSGLLPHAAIRNVLQCYLELAMLSTEYPSGELLTVTTDIIEGIRQV
QAATHAAAPSPPKPSVAVGGGTGAATEATGESSLAADTASLQRLSPQEQQHVRTCNSGMY
QQLAFVLGYLVRLLTGPPTLTAPVAGWARRQEAFKAMALHPQFFASLVSLLTPTAGTLVI
TVRDYFTWYIAHAQPLQQASGISGTVAGRGSAAGSGEVVPTSAAQNDEVGAPSAKVTVVN
GTHDGNGRALSNYDIKGS
Download sequence
Identical sequences A4H4V5
gi|154332266|ref|XP_001562507.1| psu|LbrM07_V2.0120 XP_001562507.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]