SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LbrM20_V2.2060 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM20_V2.2060
Domain Number 1 Region: 998-1154
Classification Level Classification E-value
Superfamily Sec7 domain 1.57e-54
Family Sec7 domain 0.00002
Further Details:      
 
Domain Number 2 Region: 1401-1420,1523-1784,1851-1978
Classification Level Classification E-value
Superfamily ARM repeat 0.00000672
Family Mo25 protein 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM20_V2.2060
Sequence length 2421
Comment | organism=Leishmania_braziliensis | product=hypothetical protein, conserved | location=LbrM.chr20.1:856293-863558(-) | length=2421
Sequence
MEKGIEEILDACSRLLVEMKSGTRERAMVSTVSKALKRHAQQTSQQQHQLSTQSTPSKPV
GATLVVPPTSTSSHNTSVPQLSAASTSPTGGERMAAPEVVGEANTETPDAAPSVAAVTST
PSSSPVSLPASTTACSPLQQFLCNDEELSKLAYACRMAIVGENGGIARNSVRILTAALEL
AAVVLTSGILPSELVAPAPTFTVPVLTASGTKMFFSKLLGGKKRTSSPSGAGAPNAASTD
GISTLTDTLGPSENMRDYLVDAVLAAVDTVQSKESSDRLYFVMIVALKAAAAPRLSRKES
IDTQPSALQPLQLSVHGCRLVSVFRVLLGVCSRPAGVSPILIDEAQKALHTITRALSNYV
EQGVADGSDRGCACGCLKEQATPSHSAMNSSAGTPLMPLPTAVISTSAGKSTTPSFDDPL
LQCTETDDGAPPEKACEAATQKTSLATSSTITAAAEPLVVPCVCQRAETSTAATPTTSSP
PRRLRGVMDMLLLLELCGHIVRLTPLSGISSILSASGGGLEAGVVAASASVYRRDTPSNG
SGGGSGSAAPQAPSKTPGNATEEGASIKGYSAALLNEHTLVTALSFLLYSIVNGGPQFRK
SADIVQLLRQAVVPAAIRTSISADLDIFRLSINVLSSCCLRFGPQMVSETSTVFRHVYFR
VLDSCFTSLEHKLLVLEAFGSYIEEPQLLLGLFLNYDCKTHSQSFFEMMIHYLGALAMPP
AQQVRNTNLVSELKRVLTVRLEYDVPEPLRRKALVSLLQVSDSNIQWIERFECDQEEDGH
TGTLSNKGVSWHGSTTDAEPDVLASTSPLMRKLSEDGLRCVRNQAQLPCVDIMGLSMSGG
GANGGLTATTNVDAFLHARRYRDAFKKFLEMFNQKAAPDAAIEYFGNSVLILECADEAVS
ASSEPPVAAGREFPLDNRAGVATDSTTATATTDESASGRLCNANTETQSGVDAVLGGAEQ
VLGDGDVEAAAESPTPVARATTPTGTITTDVDDAMLLSARQVATFLRGNEDYLDKMVLGD
YFAKCFRNPFSRVVFEEWIRLHDFTGKTLDEALRLFLGGFKLLGEAQVVDKTMELFAAQY
CRQNPGIFASADTAFILSFSICMLNTDAHSPHIKNKMTKEGFLQNNRGIDEGNDIDPSIL
DGIYDRISREEIVLRPSAKCCTQPSVHASAAAAADGCGGRRGSKLTTNLLDSIPLLRHLS
PIAAAITDKVLLPMDAAGNALFNSARRKREDMYQQELRATLKEVMDALQEASTHDAAHHA
MFVTATSIENALPMWEVSVDVVCHIVVLALQQLLEDSEKYVRPQGLSPPSAGNERETGAE
YEAVAAYMEDTQSTGYFSTILLGLHNTVRVCCAFGNVSHTEKLLEHMFELTRLTSAIILT
AAPSSRVKVKSTIPLTRLQVLSTFLNLFVQCGSSFNARGWQMAYKAMSLVDALANGIEGM
WQRQTRRLLGTTSVARETGVVLSKPPNSTIKPAVSLASAAVDTDSNNPSRSSPVATALEQ
RQYVDLWFGALDDVPASVVDRSSCENRKAILLALRSVPTCHVDLWLDRLFDATQYPPRVQ
LEMTNGLVKVCEMELQHTRTFSLTKLFDFVSICASFLSRLQWRDLWAHASEVFTLAGCRS
NSDIALSSLDGLRLVALTFLMREELLNYSFQKEVLKPFESILMSNQNVACRQKVMMILSE
VIDFRAEHLASGWNVVFSCLSHAAAIPEVAPSAWSICEGVILRHISFVKDCFSDLIFCLT
TFACSGVEESMPLRAISYLVACGHWLQYGLEAPPLEVRTADAITRWATRFLTPEQELAGL
HTVSKQLSRVTLSAEPLTQDSLLQKPITFTSKTKYHLWMSLFEGMMPIVVVHSSVRVRAH
ALSSIWTLLAQYAGLFDAEVLSSLFSGMVRPMLTTLLTHVPGDMDAMSTPMSIGTKYDCF
DYRLLIYFALKGMLLACKDHAQLLELACKVLTELVVSTKITLSMLRSGYVDEILRVCCDF
VWAAPSLATMDALDGLSSTSGASSFTDAVNYTERLYQWIPAESRHSNPFVVSLVREIQQV
GLVDVIHFERTADWVELHQTPAACNTPVHVSLSRLSATSVQSASAALLQIRSTIFVCLTQ
GLLGKLQGLLSACEADHNVCLEVSGAMRHVLLGVSFYFLVTRDARAVGFLKSVMATSHEL
AVVNSHGVASHTESAVLATAAGDASVGDGAPQSRCSFPDIAAISPAYITTFANPVPEMLL
LIPYACLLIEFIAAFDLGEADMNVVRNDLWVYVGRYLDELKRSRLTCIELQSAAQAGVRA
ELEVTGATTTPSTPAKEAVKEYKSCHFSDVFRSARYPIAARTHYLTAQSDPPIRQRVFSE
WCYLLHIYALKCIAILGAGSVLLQTCPTHDLINIFRVIPSALEEAVGSVYFNSCWEEMNL
HCSMPPESCVELCARILESRM
Download sequence
Identical sequences A4HAW7
gi|154336503|ref|XP_001564487.1| XP_001564487.1.15230 psu|LbrM20_V2.2060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]