SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LbrM33_V2.3330 from Leishmania braziliensis MHOM/BR/75/M2904 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LbrM33_V2.3330
Domain Number 1 Region: 289-424,473-640
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 9.42e-55
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0000863
Further Details:      
 
Domain Number 2 Region: 10-108,144-286
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.24e-36
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LbrM33_V2.3330
Sequence length 680
Comment | organism=Leishmania_braziliensis | product=tyrosyl-DNA phosphodiesterase-like protein | location=Lbr.chr33:1383189-1385231(+) | length=680
Sequence
MLMSGGGSAQHAEASFPFWTNDVDPFTSVPQCDVAPSCSLLRLRDLFCCDVADTDECWQY
ILLSSYMTDFRWLLRTVPELSAVTGKLVVLSGEKGTATLRCTTGEPLHSYTATSPLLDRV
NPFVASLREHAQTTSAVGTLLSRERLAVLEPPLPIAFGTHHSKMALCVNSRGLRVSIFTA
NLLEQDWCWKSQGIYVQDFPWKTSAKSSKHDSLDATAGTATTGYSSSNFSGVCPKGIDFA
EHLRHYLIQCGVSLAAAFTSLKAAASLAGPLGIFETDFLSHIDFSAAAVWLVSSVPGTHA
HGEVSPGYRVGLCRLAEVLRRSPLTMATTPASVDLIWQYSSQGSLNSTFLNTLQAAMCGE
AVTVIESGNAPRGVRDVLVVYPTEEEVRNSWEGWRGGGSLPLRVQCCHEFVNNRLHRWGS
RAEDHAVEHGLTQPAKGVAAHASREDAVDVDQADSDRDEEATASLVASCAAYRQFALPHI
KSYAAVAPDRTCVRWFLLTSANLSQAAWGSVSGKVKKRGLCQQLVRSYELGVLYDSHSAV
DPSVWFSVVAKSGIQLPTAHNSRPMLYEVPFGIGPRGVCLYTPYNLLYPTPYASTAALRE
QRRVSDEGEQAVASVALDCRDVPWVLDMPHRGKDAYGREVEEAFESTVPPPLSKWHPCMH
AMTTASLLRARAPCKRTREA
Download sequence
Identical sequences A4HM15
gi|154344310|ref|XP_001568099.1| psu|LbrM33_V2.3330 XP_001568099.1.15230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]