SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ000313|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ000313|conserved
Domain Number 1 Region: 249-361
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000406
Family Spermadhesin, CUB domain 0.0076
Further Details:      
 
Domain Number 2 Region: 23-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000124
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 745-799,826-889
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000602
Family Spermadhesin, CUB domain 0.0096
Further Details:      
 
Weak hits

Sequence:  CPIJ000313|conserved
Domain Number - Region: 414-459,673-727
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000122
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number - Region: 1073-1107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000288
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ000313|conserved
Sequence length 1177
Comment hypothetical protein|protein_coding|supercont3.2|2058329|2191573
Sequence
MNIKAIHWSLVAALALKLAGIVVVHACKISEHPCKGGAFCVPLDKYCDGKDDCGDGSDEP
KMCTVCNRTYYGDIGRTYSLTVPPPQWNRLPFLCHLTFTASGNEQGDIVQIIFDRFTVGR
FDEGLIDPDLDSSDASLTSGGDLPGCPEGFMQLSELGRPFTGGSWCGKASGHQLYYSETA
TVTASVKVFHAPMQAGTPFEFRIRYKFISQSDAIVRYGAPNELLELGRVTPGTYCTRQYD
ECYRKKCRLQSPNYPGMYPRNVTCYWTIRQKVVPTCKHAMVAISQENEHKALVKRSIASM
NKTSRAVRAWSDCTGERDHLIFYDGSSTNDPVLAKYCGGDWLPRVVSRGPEMLIAFHSSP
FSAPLQSGQSNRGFELDVDILFADSDSHDFAQGHKCEFHINASSPDEVLYSRRGRMGHLL
SPRHTLPPNTTCTYYFHGIPSDLVWIAFTNYHLQILQQTGSGDNGTSIKSESAHPWITRL
RIWDSAGTYVPIKTTSPSSIITTASSSSSSASQSSQSSNAATGVTQPVFAGTSTTALYQQ
LMNRTVGTYYGTINQHGKNLKINVDNVWNPVDQYIYGPTVNSIFNQPHPQPQPHPVSGGM
GSEKGLVFGGSIGLQEKMPKYSSGGSGKGKDGSRHGKDNEVVKESSGRRDKSSRSNERRR
MVAEFYDNDAPKLCDHVSLESNNHRMRPCTPLESYVSAGSDLKIEFHTMTGTSLFPSSFG
IKYEFVDTELGGEPYLGQKGEDVPLLCSRVFRKRKGEFQSPRNVFLHGRGGASNITCLYR
FEASVGERVRIDLFNVSFGDSATCTTESDGHTGRAKCTPSEADPDGRVGELRLFDVPYKD
VKIPLGCFCDNTTSSYNSPLTFVSNSRTMELTFTVTRLNISEDFAEVYFHAAYDFIKVPE
CKKRLKLRGSGGEDEVNYPLKSHEASCDGLPWYIEAQQQDRSLFVRTWGGFLSLDPTQDE
FSKCNTRNRLLVYSGKPLKVVRVICPSSSSSRSSALHIFSEDWLSSQPFLSMDRPVSMVL
EPIHKEPGSIAFSWLEIQRTKASLIQQLDLQTNFTANDTLVEFGLYPRETECEHRCPELD
ACIGKVLWCDGRPNCPSGYDESEQECGSRLMELPGGIFAAFGCLAAALSACLIFCVLAMV
KKRRKSNEKLKTAPASLNGTLSKKDYKKEPLFFDPDS
Download sequence
Identical sequences B0VZK2
7176.CPIJ000313-PA XP_001841887.1.94360 CPIJ000313|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]