SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ000326|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ000326|conserved
Domain Number 1 Region: 190-284
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000109
Family Spermadhesin, CUB domain 0.0081
Further Details:      
 
Domain Number 2 Region: 431-463
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  CPIJ000326|conserved
Domain Number - Region: 89-168
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000314
Family Spermadhesin, CUB domain 0.013
Further Details:      
 
Domain Number - Region: 301-375
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00301
Family Spermadhesin, CUB domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ000326|conserved
Sequence length 671
Comment hypothetical protein|protein_coding|supercont3.2|2508156|2514396
Sequence
MKSVSGGKRWNKHAKLRQLVVLAALAVVSGVEGLPKVFRNNEICGMYNGHRVYLELGDRG
QLQATNVTFSKSNHTIPSICTLELVTCPSCNFKISLSYSNFPTKCAFLHNELPCRCDYLE
FSEPPFDVDQSGRRNCGHDVVYQTQTRSVLIRFLYWGNHSHAFTLEYVAERNRETLQGNP
GGVHNLTGAHTRTIMTPYFPSYYPRDFGKEYVLSCNVESCRVNVIFSDFQLAKTSSMEFY
DWNGQRLYAISGGSFRPPVVQSSGPSMIIRFYANGGSGLGYRAKVSFLTVESAANPMMLP
DSNCGGVVENIGGAITMMNLVPGDNETRIFDCIWLLKPPNTYAHLKTHLSLKIDTFEKMG
PNSILTVVQGTTSDNAILDVVRPNLGGGLFGPHTYVAPLTAGFYVHLRASFRLQSRMALV
YTAFSYLDCFMGSEFLCKNRKCIPVQLRCDGFDHCGDGSDEPDSCEIQWETDRIDRRWYS
HTPNYYFPKMDRYPDLRTATIIFVASSVGLIMLISALIILLYRTGNRARQQRELQSQLQT
ISELLDSNAPRGPEDVDEPPVYEAPPDYDEIIKVGMDEDMHRKRRRHSSSASGRRSRMRR
SRRPSNVSESNNPILEVRLPPEFEGDGPSTSGMLQVPYASHDQDEDNDDLRDTPWMRTEP
DFFMSSRIIGE
Download sequence
Identical sequences B0VZL5
XP_001841899.1.94360 7176.CPIJ000326-PA CPIJ000326|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]