SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ000808|low-density from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ000808|low-density
Domain Number 1 Region: 359-610
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-51
Family YWTD domain 0.00000303
Further Details:      
 
Domain Number 2 Region: 663-923
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-44
Family YWTD domain 0.0000195
Further Details:      
 
Domain Number 3 Region: 64-299
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-41
Family YWTD domain 0.0000227
Further Details:      
 
Domain Number 4 Region: 970-1199
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-30
Family YWTD domain 0.00035
Further Details:      
 
Domain Number 5 Region: 618-663
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000902
Family EGF-type module 0.019
Further Details:      
 
Domain Number 6 Region: 1323-1358
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 926-974
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000659
Family EGF-type module 0.016
Further Details:      
 
Domain Number 8 Region: 1274-1322
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000576
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 1358-1397
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000223
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  CPIJ000808|low-density
Domain Number - Region: 312-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000726
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 1234-1283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ000808|low-density
Sequence length 1672
Comment lipoprotein receptor|protein_coding|supercont3.8|465796|476865
Sequence
MHLAPNQQQTTLLSLLSLFRTMSLILQERPDRSVLAGSSASSNQLLYTTYNDIRLANVTI
AQNTTCSVEVLVRDLNEASAMDFYYDRGLVCFTEHNTETIQCAQMRQDQSSSVNKTAVIS
HGLDKPEGLAIDWYTDKLYWTDGETNRIEVATLNGRFQKVLVWSDLDQPRAIALVPARQF
MIWTDWGESPKIERASMDGDPQSRTVLVHDRIFWPNGLAVDLEHELIYWVDGNLHFLDVM
NLDGSNRRTLVNNLEYPYSLTFAPNFLFWTDWQDGTLHYYNIASEKHEEIFDSPVVPITV
HAWDSRLQPASDNPCRQNNGDCSHLCLLSTNMAGYSCACPTGVKLLIKTQCAEGPQDMLF
VVQRTQISRISLDSPDYTSIQLQLGKVRYAIAIDYDPVDNYIYWSDEGSNAIKKVRPDGT
GMVEVVNTEILGPDGLAVDWLARNLYWTDTGTDRIQVCRLDGTFRRVLIYENLEEPRAIA
LAPTLGWMFWSDWSEKDPKIERASLDGTERVLIVQQNLGWPNGIALDVEARKIYWCDAKL
DRIEVANMDGSGRNIIISDNLPHAFGLSLLGDYLYWTDWQRRSIDRANKINGNDRTVIVE
SFPDLMGLKVAKLGEVKGTNPCARGNGGCSQLCLNRPRDYVCRCQIDYELDRDNRTCFIP
SAFLLFSRHDTGSIGRISIDSHNHTDYAPFRSVIDAHYLDVDIADRRIYWASQKQKHISR
AYINGSNVEKIVESGLIQPEGIAVDWLAHNIYWTDAEARRIEVARLDGSSRRILIWKGIE
EPRNLILEPRRGLMYWAEWPSDSIRRAVMDGSELKTIISGANLATGLTLDPDTRRLYWAC
QSSPTAIESAEWDGNKRKILVTADTDNPFVPHAVTLYKDYVYWSDWNTGEIERANKSSGE
NRTIVHTGLKYTNSLLAFHPFRQSGSNQCRTNNGGCSHLCLALGQRKMTCACPTHYTLNA
NRVSCSPPKNYIIFSQRNSFGRFMPNTTDSPDVPLPVTGKNIRAVEYDVLTRFVYWIDGR
GPIIRRAFDNGTSAKVFIDPASSPFDMVIDPIGRLLFWSCSHTNTINITTLDGEIERIGN
VDIGPSEKPRSLALHPSKRLLFWTDVGTAQSIIRAKLDGSQRRELVSKLEGITALALDPQ
LNRLFYAHGKRIDMVDIEGREIKTLVAEHISLVSSIAALNGYIYWLDERPGMERISVLGE
NRRTEIQKIPHITDIVAVWTPEGRALRNHTCSTRAKCTHICIGSPEDAKSDDMCACPQGL
MLMKDRRSCGALPVCGPDHFTCAATFASSGLDGDNNKDCIPVSWRCDGQKDCPDRSDEMD
CPACRADQFKCQSGECIDKHLVCDGTTQCLDGYDEAVCCKNPEDFQCPTSKVCISYHNVC
DGDEHCANGEDEAPEICAEYNNRRMAPSGSKITMLIVVVIAVAVVFIVVYLLQTCRSRFG
AGSSEPKEDQAAAPLSPGGIHKNIRVSKLSSVADAVRMSTLNSRNSTNSYDRNHITGASS
STTNGSSLIGYPLNPPPSPATIAGSARYSSNYHPYKHYKIINQPPPPTPCSTDACDESDS
NYTSKSARSRDGRIINGGGGGGTSSSSGRGGIKYHHSHHHHVNNNSSDRYDSEPYPPPPT
PRSHYHHSDVGGMREEHYNISCPPSPSSRSSTYFSPLPPPPSPVPSPSRGYS
Download sequence
Identical sequences B0W147
7176.CPIJ000808-PA XP_001842431.1.94360 CPIJ000808|low-density

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]