SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ002112|serine from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ002112|serine
Domain Number 1 Region: 969-1212
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.36e-68
Family Eukaryotic proteases 0.00062
Further Details:      
 
Domain Number 2 Region: 1824-2032
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000000552
Family Eukaryotic proteases 0.0031
Further Details:      
 
Domain Number 3 Region: 2087-2124
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000124
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 4 Region: 2158-2196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000851
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 726-766
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 2049-2081
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 1221-1258
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000113
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 8 Region: 1559-1595
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000471
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number 9 Region: 1624-1662
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000576
Family LDL receptor-like module 0.0039
Further Details:      
 
Weak hits

Sequence:  CPIJ002112|serine
Domain Number - Region: 770-791
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00641
Family LDL receptor-like module 0.0042
Further Details:      
 
Domain Number - Region: 2124-2158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00668
Family LDL receptor-like module 0.0045
Further Details:      
 
Domain Number - Region: 816-842
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0119
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number - Region: 1604-1622
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0223
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ002112|serine
Sequence length 2328
Comment protease nudel|protein_coding|supercont3.21|718833|727954
Sequence
MDKPQKSEKVDLLRCRKKIILKRLSLLGLVLVTVGALFWIAGLLSVYLTNTFSAPKPVSL
EGNSFIFTYRSEIHSTSSNSISDTVLEPIRNLLSSVFNLLGIQAEHNTRNKRDIEQDNRI
SLVDHNQLDKEEDQSNEHGFVAVSPEVVTQSKRTLRILYAPLENEQTQHNDIIRSLKRRK
RRSLRDKRYASAIKELENEYSRCKKEIPKERDCEKIYEKLKKLSEGINKNFIAMSNLIHD
FQDKQSADLAKELSDRFPKKDHKKYKEDQDSDENGERKTMKKDKPDVAQPSNWPTVHAMP
SNMQLVTEIMGTTTSLPSSQQKGNSTLQVNNATHRADVQTLDDLIQSIKSTFMNDSKQSE
HFNPAYHNPVTVDCVKNLDQLLETLEEFKTGNVTNKNCTKTNHSSTPAPGDFRFAKPSHS
TNSPYKAEDHRPHVDECIQTLDDLMDTALFKKSRKCSPKAPSSPQRNIPDTTIDTLHSQF
GQPAHPIHEELGDHSTEPQDIHDFIMARSRNRYQYNHDYVDHRFPTTIEAPDSRTTKQMA
TLGASGPFLELCNQFRNQPNQQGPLKTVSSNHHNFQAQQFGPGGFGQPNIPITGETLKAS
SHVSFNSAYGGFVPNHFCFYQMPQQYGAVRPGYGGVQTNPGGIINVPVNIHNIPGQRSAG
EIPPGSQLICNIVPAKATTESYQSRAISQPTPNDDGIEPRITSGNVSAGTEPTPHQDSLR
AHGNRRRHCVRGWIPCANGQQCIRNTEWCDSKTDCLDGSDESHCSCLSRISEKRLCDGYA
DCPLGEDEMGCFGCDKFSFSCFSNAAEHDAAHKSGAMCFTAIEKCDGFDNCLNRKDEHDC
TMLVKDLGSPLAFAVGHSHGILHRNHKGKWYPVCHNPTVLARDACESEIGPIDHDPQITQ
RQGHLPGPFIQPSLQSPHVFHPEFLETCNGFFTYVVCPQPKCGTTKLNEFPSARIKIRNK
RANPDEVVESTRIVGGSYSEPSAFPFIVAIFRDGRFHCGGSIFNEHWIISAAHCCDNYHK
HYYELRAGMLRKHSYAAHVQVSLVTHVIVHQGYSAEKMINDISLMRSDRPFGFNRWVRPI
CLPDRHRTTNDRDWKWGPKPGTLCTAIGWGAVREHGGAPDHLKQVTVPILSYCKHKSDRE
GLEICAAEEDGGQDACQGDSGGPFVCVSITNPHEWYLAGVVSHGEGCARANEPGVYTRVS
LYIEWIHQKVHEPPPHMTARLTCPGFHCTWGSPVCLPVEKRCNGVVNCLGGEDELHCPLD
QMTGIFLNRTTTESAANATTSVPTTSKSSTTKPAKARAEEPVAQLSAIASSDIIVSPVDD
RTPNSEVNEQTTTYKSTLTNTTSRSVTTVQQTTLPTTTGKSATSVNHTTVSDTSIHTSTI
RTREATEAVIGVAKNLSTTESTSSTASTTVADTTPVTEPVWIQVNKTLTNLHPHVPSSRL
TNENTTEESVQSPLDEQDQEQFTTEATLETTIQPLQEINATPHPLEAQPIEPIHHGHDLE
QSETQIRESTGIEQLHPFFGQLVDMHEARHRRLNQFRLSANNLHTSLKNYSNLNETYRYK
RFSCKNIHQTINLAHYCDRVIDCEDGTDEMNCTCRDYLQNKYNFLICDGKTDCLDQTDEK
DCFSCLAGQYSCRMSKMCIDERQYCDDSPHCPLHEDELDCLALTNGRRVIFDANGLSMFN
HEGFVTKNTKGVWNVMCGIEITNKTAEAVGKICSILGFAGYLNYSNVILGDTETDLSFDT
NSLLIKSYQNVSSEPNCKALRIVCVPYINATEHEISHFENQHKELPVQINIHPKNPIENP
HLHPHITFHENAHIEIIENFGDDYDWPWNADIYFEGLFLCSAVVIDVNWIIVDSSCMRLI
NLKHDYISVVVGGAKSYLKIAGPYEQVSRVDCYHFLPEAKVVMLHLERKLNFTRHVLPTF
IPEKNHNIEDNQCLAVGQDKLGRTRTLRVHLNMTDCTPEKHICYQRDPQRDYYHAEHCYS
EAATRSGVIVCKTKLSGWYPVGFYQNKHGLCGFNDVVKIISLKEFFDDIQHVLGHQKCDY
EFNSPPCAGTRCRYGKCIEKAMLCDGKLDCNDGSDELPELCTNHNSTIAACRPAEFRCNT
GQCVAKNRFCDGHNDCGDLSDEPHECSCYTYLKITDPSKICDGFRNCWDKSDENPRLCKC
TTNSFRCGESGTCVPFDFVCDGEIDCPSSEDEKFCYALQQNPTETNYGEVMKQSFGIWHS
KCFPKDVRYDDQTIKEICDSIGYHRIAKVYGRKMLHESRLRTANSTDNPVDRLRKAATKA
VVLNKFSKVLINEKQSYFMKPSRPMFKLVNWDEHDEQNCDRLEINCGE
Download sequence
Identical sequences B0W3U6
XP_001843380.1.94360 7176.CPIJ002112-PA CPIJ002112|serine

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]