SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ003163|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CPIJ003163|conserved
Domain Number - Region: 32-78
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0633
Family Glycosyl hydrolases family 16 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ003163|conserved
Sequence length 204
Comment hypothetical protein|protein_coding|supercont3.43|399151|400193
Sequence
MYLTEDLPSISALNKIEMSLSVVKSVFRNHPIVKGMVTYSILWPTGSIIQQTMDGKNWRT
YNYRQSLNFAIFGTFFVAPSLYGWAIVEQFSYGPLAGTSFFFGMSLLEQKTTKEAVQEVK
DKFPDTYKVGVCVWPIIQTINFTLIAEHNRVPFVSICSLLWTTFLAYMKQRPEHSSEDDI
VTDGVTMGSPKTIEIEVQRKLAAL
Download sequence
Identical sequences B0W7R7
XP_001844751.1.94360 7176.CPIJ003163-PA CPIJ003163|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]