SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ003741|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ003741|conserved
Domain Number 1 Region: 39-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-20
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 256-384
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-19
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 3 Region: 393-518
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-18
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 4 Region: 158-240
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000576
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 5 Region: 533-574
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000645
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ003741|conserved
Sequence length 823
Comment hypothetical protein|protein_coding|supercont3.51|1102233|1123609
Sequence
MPARERVAIFCVHEYMDVYAEVQSSDPAELINSPFGGRYCGPIPPHMSCTYQFIGKPNQR
VRIEFRDFDLFFGGPHCPFDYVRVYDGPDNTSAVIGMYCGQQRNLVLYSSEQYLFVHFST
LQRTANTQNRGFKGIFEFSESFVKYFVYGMQDAQNLERVKLEFSIFEIPKGEQKGDSNCT
DGYLKVYLKGQEVADAYDKFDHELCGNELPHAVISDGPRLVMVFSSGELQGRGFKAKYSF
ETEYKIPGTAAPDGTCSFTYRSTSRKKGEFNSPRYPSNYPSETNCSYVFLATPNEQVTIV
FDHFKVKADGANTTYGAYGASVCFEDWLEMYVLYRDGTDRFLGRYCSLTAPGPVESPRGA
VGIRVVLHTDQENVASGFKARYIFETAKSVFGDCGGNYSGEDSGIVTSPNFPANYDAPGK
GLASRACNWYITARPGYKILINFDFFAIEGEPATRGCAAAVMRLWLSPDSDMPPIEMCGE
KPAMEHWQYVTQGQTARISFTSADKAIGAQGFRIIWTEVQDSPGGPSSTMALLCESTYHF
QCLASGYCISERLRCDGVKNCGSQDNSDEMHCTILVPDEDHGALIISCIAAALCLICLLC
TLCHRKRKRRHHRQLGLHRNAAHYDSTTSATGISLGSSRRHLQGGGSLSGSLHGINNEPM
QIPPAPLPPVSVPPHVCINDTLLDTDDLDNDLFVNGCDRFDDNGECCSICHFCQHFYRGR
YCCSFYYYYPYDYCSKMMALLCLSNVPVGNRRHVNNNNGGGGRGSSGGGDGGAVRFNHPS
RAHSCDFDEYYYYIQQQQQARQQQQQQHPATAATVDTLKVIYY
Download sequence
Identical sequences B0W9D0
7176.CPIJ003741-PA XP_001845314.1.94360 CPIJ003741|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]