SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ004220|very from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ004220|very
Domain Number 1 Region: 1308-1575
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-48
Family YWTD domain 0.00000345
Further Details:      
 
Domain Number 2 Region: 3069-3329
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-43
Family YWTD domain 0.00000393
Further Details:      
 
Domain Number 3 Region: 613-873
Classification Level Classification E-value
Superfamily YWTD domain 8.37e-37
Family YWTD domain 0.00005
Further Details:      
 
Domain Number 4 Region: 2273-2512
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-36
Family YWTD domain 0.0000273
Further Details:      
 
Domain Number 5 Region: 1625-1887
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-29
Family YWTD domain 0.00046
Further Details:      
 
Domain Number 6 Region: 346-554
Classification Level Classification E-value
Superfamily YWTD domain 1.09e-27
Family YWTD domain 0.0000975
Further Details:      
 
Domain Number 7 Region: 1963-2178
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-27
Family YWTD domain 0.0000848
Further Details:      
 
Domain Number 8 Region: 3900-3922,3949-4116
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-23
Family YWTD domain 0.00028
Further Details:      
 
Domain Number 9 Region: 2982-3059,3332-3383
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.59e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 10 Region: 62-100
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 2603-2645
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 12 Region: 3411-3451
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 13 Region: 3580-3617
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 14 Region: 3495-3534
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000628
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 3534-3572
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 16 Region: 2771-2807
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 17 Region: 2725-2769
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000969
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 18 Region: 2648-2681
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000111
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 19 Region: 2567-2604
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 20 Region: 3731-3771
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 21 Region: 3615-3655
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 3696-3732
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 23 Region: 2944-2981
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 24 Region: 3774-3811
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000982
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 25 Region: 2899-2934
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000122
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 26 Region: 3658-3695
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 27 Region: 925-960
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 28 Region: 2855-2888
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 29 Region: 2684-2723
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 30 Region: 3374-3410
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 31 Region: 1581-1633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000318
Family EGF-type module 0.017
Further Details:      
 
Domain Number 32 Region: 2812-2850
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 33 Region: 232-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000785
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 34 Region: 1003-1047
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000942
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 35 Region: 969-1007
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000262
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 36 Region: 1889-1942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000347
Family EGF-type module 0.017
Further Details:      
 
Domain Number 37 Region: 1051-1085
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000615
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 38 Region: 1183-1217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 39 Region: 2201-2249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000237
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 40 Region: 104-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000458
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 41 Region: 155-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000471
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 42 Region: 4308-4344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000742
Family EGF-type module 0.011
Further Details:      
 
Domain Number 43 Region: 1230-1271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000967
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  CPIJ004220|very
Domain Number - Region: 4238-4275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000108
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 3455-3496
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000131
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number - Region: 1265-1302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000395
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 4438-4475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000479
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 4344-4378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000541
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 4275-4308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000652
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 883-920
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00101
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 4381-4416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00148
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 3818-3855
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00508
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 1088-1118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00511
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number - Region: 558-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0152
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 203-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ004220|very
Sequence length 4695
Comment low-density lipoprotein receptor|protein_coding|supercont3.63|265829|287156
Sequence
MISCHHVKTIYDYLNLGEKTPPLHFLKQIHFGDVSFNHDNSKLMAELALTVLSPQLEITA
KPGTTCPRSHFTCGDGKCIPQHWKCDTYSDCADGSDEIDCDKTHKCKDEQFQCKLTNKCI
PRGWTCDGDADCGVVEKFRTIDVSDEDAELCRSSRHCLPTQTVCSNGKCLDIDRFCDGVW
DCSNDELRCPKNTTTVAECDALKCSYDCRQTPNGPRCFCAKGSQPNGSICEDFDECQIDG
MCDQICKNLPGTYKCTCATGYARIGNQCRAVNTPKEEPASLLFATSTEIRKFPVINGSAV
PDGHPNSSTIALPLHNVLALEMYHRNRTFCAVRLDVDALFECFSVDNVTHTWQMPLPDLF
PNINSIDHISIDWISGNWYYLDDQREIIFVCSGQMRHCTIILENDLMKPRGMALDPTKGF
LFFTKWGNSLASVERSFLDGSNRTSIVLKKIVYPHGVALDLAMQHVYWVDTYLDSIERVN
YDGSNRWFLKKSANFMINLQSLHTVNVFETNIFLASWKNRSIVAIDKFTAEARLVATNVS
RAYHLHVFHRQKQPEVAHPCRNQNGGCDHLCITAWKKTVAIGQCLCSPGYRLKTKNQCVL
IKRPTFLIYAKSNPGMIRGIPLGIKAQEAIVPVTNLGRDITFDYHIEDQLIYFAHHDKTQ
SKFSIEMQKLDGTGRAKIWEAAGSCDGLAYDWVGHNLFYTNSARGHIVVLKLDGNASAHV
VMRDLARPESIVLDPKKGLMYWSTWGPDGRIEWAWMNGTERATLVQGVDGSPMIWPSGLV
IDQVQKRLYWCDSRTGRIESVSLEGHDRTLLYDGGSRNHFPIAIGVYKEQIFFSDNVKGN
IERLNLSNPDSVDTVAIEKPQIFGIKIFDNLTQYNANHKVLCDGKCPDICINTPVGPFCA
CGEPLVMNGNGTNCVAVDSAAPATCYDGTNFMCKNGVHCIQQKYTCDGDRDCDDGSDEEP
APDGPCNAHCDLEHFFKCDDQRCINRSLVCDGTVNCIDESDEDFTNCPNQTCIDNFFQCN
TSRRCIPKSWVCDRHPDCGPNDHSDEPENCHKCEEFECKNGVCAKFEELCDGTNNCGDNS
DEAQCDVECRPSEFYCSPYGCIDRSQMCDPKLNCLNAFSDCEQQQRNASANGTTVSPSVK
TEEEMRGQCRFDINLVCDTDKECIKAYQKVCQNITFPSFNETTVCQHPDRICRVTNTCIK
VEQLCDGRPDCPDNTDEGFHCKDNLCKNVKECSHTCHNAPEGFVCSCPEHLFLQPNGKEC
RVDHACTHWGTCSQVCTPDEKHYKCSCLEGYTMTFDKFTCKSNNVDAPHVIFSNRQEIRG
VDLNTLAVKNFYTSLRNTIALDFLWKNDSVQIFWTDVIDDKIFRGTLIGDSLSNVEAVVQ
SGLSTAEGLAVDWIGMNLYWIDSNLDQIEVAKTNGSYRRTLVAGDMVNPRAIALDPMEGL
LFWTDWEEGAPRIERCSMAGEARVTIKMVGPEGGWPNGITLDYVLKRVYWIDARSDSIHT
TDYDGNDDHLVIKDQEVLSHPFSITLFDNYVYWTDWRTNSVIRANKWNGSDVTVIQRTQS
QPFGIQILHSSRQPNNRSHNPCSDNNGGCSHLCLLSVNQTYQCACPHVMRLDTDKKRCVP
NEQILLFVMSTEIRGVDLQQPNHYTIPTISHQTQVVQPAVLDYDIAEARLYWNDVLLKEI
KSSELATGPIETILDTDISNSMGFAVDWISRLLYVSTGTETSSRILACNMKGEFLTEILS
GLKAVYSLVVHPSKGMLYFATIHESPNLYELYSARMDGSEKQLISNSTFNAMESLVLDFE
TDRLYYILSKLGEIYYYDIATGKIIKVLESQSKPIHTITIYREHVYFDDSVESRIVRCDK
NVCQSPEVVRNNTGGVSAIRMYHPGAQNGTNPCRLNNGGGCQHLCIPLSGQSYVCRCAMG
YRKDAKNASKCVAIDNFLMYSIGYQLKGLPVGEASDQHEAVMGPLQKISMATSIDYHAKS
DFVFIADSDRGSITKIKRDGSERSVIVSNFEQVVDGNSIDWLGEIAVDWVADNIYWTDQK
RNLIEVARLNGSLRYVVASNLESPQLIAVDPVSGFIFYSGRGKIGRTGLDGTGKFILVNQ
TSAINDLTLDIENQVVYWCEVQTDTIWRVDYDGNMKTILLNNTLDNVKALDLYEDNIFWS
DVHGNIKAANVRNITNYWPVVDSDGASVKDIKIFSSQKQQKTNACGINNGGCQELCLFNG
THPICACSHGKISQDDFKSCESYDSFLLYSKVAAIESIHITDPNNINGPIPEIQNSTFLK
NTIALTYDHDQQLIYYSDVEYSSINSVFYNGSNHRKIVAKQLTVEGLAFNPITKQLFWTS
NNEAAIRSLELANITADAKANADLVRELIKLKPTDKPRGIAVEPCLAMIYWTNWNPQAAS
IQRAYPSGYGLESIITTDIRMPNAITLDYQAKKLYWADARYDKIERADYDGKNRVVLAHS
TPKHPFAMAVYGDLLFWTDWILHAVIRANKYSGSDVVWLRKDIARPMGIVAVQHIDKDCS
ADPCKILNGGCEDTCLGVDGKGKILCGCTQGVLAKDGYRCVPKLSSNCSSEEFSCSIGGC
IPFYLTCDGIPHCLDGSDELQSYCAQRTCSVGYFQCNNHRCIPETQVCDSAQNCGDGSDE
ENCKCNAATQFQCKSGQCISKSHRCDNDPDCPDLSDELGCPRTRNCSAELLHCPYTTACY
MPSWACDGENDCWDNSDEMNCTTSVVPTCPTDKFLCANGHCIPMNWRCDSEDDCLDGTIT
SLSSDEINCTRHCKPNQFQCLNSTECIPNSWQCDNNPDCADGSDEGEHCQQRVCPEWEFH
CPTSGRCITMKWRCDGEVDCTDDQEDEKNCDSMEQSCDPDSFTCENGDCVSRQFYCDGDA
DCVDGSDEPIDCVPEVGVVVSCKVDEFQCKNKKCIAKNLTCNVNNDCEDGSDEDIQLCKN
TTLICAGPELFRCESGVCIVRGLLCDGSNDCGDWSDEKSCKINECEEMPNLCAHNCEDRE
VGYDCTCRPGFKVNINDKHRCDDVDECLDRPCSQMCTNVYGSYHCSCQEGYTMKANGSCK
ADSLEHPKLIFSNRYYVREVDMNGSMNILAHNLSNAVALDFDWETKCYYWSDVTSVISSI
KRMCLSSNKTEVLHKSTLKNPDGLAIDWVARNLYWCDKGLDTIEISKLDGRYRKVLINQN
LQEPRAIVLNPYRKNMYWTDWGDQPHIGKAGMDGSNQTMLVSQQLGWPNALTINFETNEL
FWGDAREDYIAVSDLEGNNRKVIIYRDMHPAMNLHHIFAVAVWEDRIYWTDWETKSIEYC
HKYRGDQCGTLIKMIHRPMDLRVYHPFRQRKPVEDPCLLAGCSTLCLLSPEAPGYRCACP
DHFLLGPDNKTCIANCSSAHFLCKTTFKCIPYYWKCDKQDDCGDNSDEPDNCPEFTCESG
QFQCDNNKCISPSLICDGKDQCGDGSDEKGCDDYECFSSQFKCSKTQFNNSFCLEGVKRC
DGHADCPNKDDEVGCDKTVCADHQFMCGSGKCITKVWACDGDIDCVDGSDERDCGNRTCS
ESEFRCNKGRCIPMSWRCDGEDDCSEGEDEKESCNPPEATTCEASYFRCNNSKCIPGRWR
CDYENDCGDNSDELNCQMRNCSESEFRCDDGHCIRGIRKCDGEFNCADHSDEADCDVSCQ
PDEFKCKGHNLCISNNFKCDGDNDCIDGSDEEDCDCHDDEYRCDNGKCILRNWLCDGIDD
CLDRSDEKSEYCKANGCHKRAFRCSNGNCIRKAMMCDNKNDCGDNSDEKASQCLKCPPDT
FRCSSDSKCIANNQRCDGKPNCLDESDELGCRRSQCGFGTCSQVCVEKKHQYNCRCQPGY
QKGPLRNDTCIAQDENGLLLVSSESDFRSMYYGTTVMGFLQTNSKKIDRFDYSITKHNIT
LFWIDSHDKSIQKVHMDTTVKVVESGEEGGAARSSRAAPSYDRIKTLDGKHSSVILKNQN
IVPLAIACDWITEHIYVINKKQSNIFTMTYNGTNHTTLTATGKHPIDIVVDPVHRVMVWS
VMEAIILSGMDGFKKQKLVQANIEWASGLAIDPTTDRLYWADYRKSTIETCMLLTGGDRH
VISEMHDYSKPKILDVFEDSVYVILYNQNILRLNKFGRDNGTEVFQGTRGYRSSDLNYIH
PVKHNRKATNPCLLHPCHESTVCLLSTENPLGRRCLCADASSQDPEKDPSGEITRCQEAP
PVRCNLSCHHGMCVIEGGRPRCQCNPLYNGTYCEHYICSGYCHNRGACYIVNNERKCTCP
PLWTGERCELSTGACQKHCHNGGSCSIANDGTISCECPREYTGEQCQHCANLSCENGGVC
RKTATDKSQCECPDGFSGRSCEVDTCINQCENGGECSIVRGSPKCSCPEGVTGERCENRG
CTELCRNGGDCVTGPSPYCKCRQGWTGSFCEVDLCDGSENQPSYCSPEHPPPSPLPKSCG
TYVCSNAGHCLEVRGEPICNCTQQYAGRHCEHYIGYHNPCNYYCKNNGICQLDIRTSSNI
TYETSCVCVGEWQGDQCERPPPCIEDCGTCEAGSSINECMCEDGRLSICLKEIVLAELDG
RDRTGYTLSILAIVLFVILIAVAGFGGALYGLKKRRNGQPFSHARLTENVEITNPMYLGD
VEEVPSFVHEDDKAHFANPVYDSMYAGGVNVHADSSSSLPGHSSHPLLSVSGSAPEEKKG
LLQHTQDDSLAQDLL
Download sequence
Identical sequences B0WAR6
XP_001845800.1.94360 7176.CPIJ004220-PA CPIJ004220|very

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]