SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ004357|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ004357|conserved
Domain Number 1 Region: 236-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ004357|conserved
Sequence length 641
Comment hypothetical protein|protein_coding|supercont3.68|629336|638405
Sequence
MNATAVSWTFGKWCLFALAVVALLGTSAEVAGQGLDSFPAQQQPHSLAKRMDLEMCLVRF
DVHLNTIIRTEESRAMGATFLDDADVNSREQCLRLCCETENCDVFVFEEKNQGTCFLFNC
GPPSNFYCKFTHHSNYTSAVLKIPTVVEPPPPQPVQPLVSQIHSLAHPQSQAAQAPTPVI
VPKLSQHEMELVNLKAPKPPTRPSSDQTTTTLIPPLGVQLGQLPATTTSSTPRPSTPAQC
GHYEFPCHSGECIAVYNACDGIPQCADGSDEGPECRRPAAQPVPQVKPIQPIPVQQPQRP
VLPPLTMEQMNPVPMPKPVFQQDLQQQELRGLQQIHNREDPMTAPKPWPRPLGEMPPSYI
DTQDSRIFNHKGGLQLQSNISPPQYPDSIPDTSYIPNIPRTNQYMPLPGNYQSGPPQQQQ
WDPRISPPQRPMWPQQPQMPQSIPQPIPQTNQQPQPQQPLQPVATPVVTSNDHPKPPIDT
PKESDPHKPAKSSEEYETYDDQYQATSGEDQEEAEKPEATQKKKQHKHRKHGDHEHEHKK
KNKAKTAKKDKAHGEEHAAPPVHEHLKMLRNDLEIEFADHDGQAERPGGAVLSLTLGAIL
TAALAIMIGCRMKVARRRIRRQGGKSSYAHDADFLVNGMYL
Download sequence
Identical sequences B0WBN2
XP_001846116.1.94360 7176.CPIJ004357-PA CPIJ004357|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]