SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ005284|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ005284|conserved
Domain Number 1 Region: 107-372
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.03e-30
Family NodB-like polysaccharide deacetylase 0.0094
Further Details:      
 
Domain Number 2 Region: 5-48
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000034
Family Tachycitin 0.025
Further Details:      
 
Domain Number 3 Region: 63-98
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000641
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ005284|conserved
Sequence length 442
Comment hypothetical protein|protein_coding|supercont3.83|1414|13678
Sequence
MWTNTECAKYYLCLDGEVFEFKCSVGLLFDVTRQICDFKQNVDNCDITAEARVPKPLLDA
AQCEERSQLGCGDGTCLPNEYFCDGSVDCADGSDEGWCDVENDPNAADPCDLSVCELPDC
FCSKDGTIIPSRLERTQTPQMIVLTFDDAINFENWELYTQKIFTPGRKNPNGCPIRATFF
ISHQYTNYAHVQKMWNDGHEIAIHSITHRGPEEWWSRNATIEDWFDEMVGQANIINRFSN
VRMEELRGMRVPFLRVGWNRQFLMMKEFGFVYDSSMVAPHSNPPLWPYTLDYKMPHACNG
NNQFCPSRSYPGIWEMVMNQLEAGDYTCGMVDTCPPHMNGDDVYKMFVHNFKRHYHTNRA
PYGLYFHSTWFRKQDDYTSRKINIVIHQGSASLETSSDARISFEVATLVGLWGASGDYIP
VFFQEILQIMRGYGDCANPLRE
Download sequence
Identical sequences B0WD94
CPIJ005284|conserved 7176.CPIJ005284-PA XP_001846662.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]