SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ006967|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ006967|conserved
Domain Number 1 Region: 1055-1355
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.37e-43
Family Eukaryotic proteases 0.00076
Further Details:      
 
Domain Number 2 Region: 824-858
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 941-977
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 904-940
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000825
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 5 Region: 862-902
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000641
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 776-820
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000864
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 994-1062
Classification Level Classification E-value
Superfamily SRCR-like 0.0000314
Family Scavenger receptor cysteine-rich (SRCR) domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ006967|conserved
Sequence length 1388
Comment hypothetical protein|protein_coding|supercont3.153|504625|508988
Sequence
MHQPRQANRNLRVNLNLRANQNQPVNPNQQANRQRPVQLNIPTNRKSHRQTNRKSLDSLT
PLRNPAVNQNQLVSLSQAASLSLAASLSLAASQNQPQITSHLPSEVEQIKAVKSSEPESE
PASEPEPASEPEPTSEPEPASEPESASEPSSTESNSGKLQSSTEYATQQQSSTKGVVEDH
TMPDFMIPDPEQKHSTSTDTISTTSLKSVSDTPAPVTETISDDTPQPTLGTYLIAARTTK
SPSTESSNVFDGRSLENNEPETTDNTVYATSSPILLEQYRSSTSFSTSTESMEQPKEQEE
DMSPFLPNIETTSAKNRALYAVTEAVQEADTVPSILNHVDQSPFLPEIENNASLVNLLHE
GLDRQAEGFDNDSQQHYLEVLPLSKENDRNDYKKQLSTEVTKTVYIATTIRYAPTTDSVE
DLLTAASSRNIVEQTTNGAEEVMNTSTERDVEETTLGKVNATLARQELLEEETTEQVERK
PTTMQVEELSSSPKQDIEDVNTTEQVEEKPTTQKADEEKTSPKEEVESVSTGDVVGKLEA
TTVEEEPTTVRVAMTSGAPAKLELEEERASTSGKAEEVTENTKEETTEAQAKIVAEVTSE
KEVEETTPHAAVSTSSTTEGADAKIVEEVTNATETREPMTTTSTTTESTSSSSTTTEAES
TSTTTSTTTEEGKNDLLKNFQDLDSDNDISENDLKVIPLQKSDVTKESPPPDPTTFQTAS
AARDSTFETTTGHFLDETTFHLIRSERSNETSLIRTRNSEAQNFGELIASVGSGMFTKCA
VGQFECVNGTSIKDGSSCIQKSERCDSVSHCSDNSDEQDCERLGCPGHFQCKDGFCLARH
HVCDGIAHCNDGSDEVECDRWQCNFDEISCNPGGGGGSCLPALWKCDGLEQCANGFDESN
CPDTCTNDEYFCVGQRKCIPEAWRCDGTADCSGGEDERLCDCPVDNFRCNAGGCVPDKFV
CDGQPQCPDLSDEWGCFSVDIGALKVRIESQELKPVCGDGWTKELSDEVCAKLGFTEAKS
FSISGEKGEDSVYRYMSTNASNLLENMALASNCSAGLVKIECEQYLCGRESITPTLEQRI
AGGVNSESEQLPSLALLYSNDAAIKCTANIISPRWALASYSCIMGKTEFIDNRNVAELDW
MLFAGTSHFNSSLVSGGSRNGTFQVVEVQRIVPYPQAKYKQFLYSGDVVLLELASPLRLN
ERIGSACLTERAMIDEEQLCLTAGWGVDPAEVANTEQYLKYLPVPTMPTEKCNSSIHYNG
SLNDDAICAGYLSSSKTTCYVSPTILAPCQLQLSNFRSPQNDEGAPLMCHVESSGQWRLE
GTLSYHGNCGKRPHPAIYNSITSSISNWIRNTVGNDRMFATSATSRSNGTTAEPVNGTQP
AVTAAGER
Download sequence
Identical sequences B0WJY0
CPIJ006967|conserved XP_001849014.1.94360 7176.CPIJ006967-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]