SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ007155|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ007155|conserved
Domain Number 1 Region: 639-747,868-975
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.7e-37
Family Eukaryotic proteases 0.0028
Further Details:      
 
Domain Number 2 Region: 321-436
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.59e-27
Family Frizzled cysteine-rich domain 0.00089
Further Details:      
 
Domain Number 3 Region: 159-286
Classification Level Classification E-value
Superfamily SEA domain 9.94e-18
Family SEA domain 0.0053
Further Details:      
 
Domain Number 4 Region: 471-510
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  CPIJ007155|conserved
Domain Number - Region: 439-470
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00236
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ007155|conserved
Sequence length 978
Comment hypothetical protein|protein_coding|supercont3.143|275299|287042
Sequence
MKSSKYPESDDNDSLPPPPPPEDDPYFDDLSPPPGLNHLNHLDTLPQTTTIPAGTTATGM
SPEKSRKQHRSSSDAKHHHRNGGNGLHHKGSNGAGHHHHHHHHHHRHSKSSRADSVLSSD
SDIRFTRRKLGDNQKCGCALIAGFLLILLFAGVIVYVGYTYLRPEPLPDRIFRARLRVVD
GDHWTPELADQSTLRFQHKSRDYRERINLIMRRSDLREPYEGSEILALDGNEGEDLTLHF
AMYFDPYAELVSAADLHSIMMEEITSDSPRFFRNLTIDPSSLIIKEVLGQFDDIPGTSSS
PLGGKDDVVSEVVTTMRPPRKCEPLRLNYCRSVGYNMTTYPNFFGHNSVEEVEADLISFR
ELVDAECFRQAFDFICRLLQPPCEYRRIEEPTAGKVCRQYCQAFWAGCGDRLPERFRRFM
DCERFPESTGIQSCHSRPGCSGELQSNALSSRMCDGVADCPDLSDENTCTFCAYGAIYCG
RGRVCYARNARCDGKIDCPDGADEKDCLSISPQVTHLTFPPPIVPHRPRFYSEGYAVFSE
KGTTGKLCSVGMESNEYVRNTVAESLCKALGFERVDFSEIRNDTEPNTSYVRVLDPRASE
ISFVRTTCQSKQSLYVSCGQLECGVQSALPNGGNVGLSKMAAPGDWPWLVALFRADTHVC
DGTLVSSDWVLTTESCFQGQAKATWYAIFGAVRLTSNAPWTQRRRIIGMVKSPVEGSTAA
LVRLENPVIYSDFVRPICLPDIPLKETIDRSDNVTPTPHAEKFSKSRSKKRIKENRQYFE
TPGDDETASSDEYSDVTESSKFSVNEFTAEFADEGSQIPKAEAVGAVSGTRNPYPLPENS
PQTNNYISPSNYIGHSFTPPKAKQTVWTNCNTLGWSRQRDHLQRVQLKISDMKPCENISI
ATVNSMCTEAAYHKQDCSEEEFAGSPVVCLLPAERKWALVGVASWRIACAPNGIERPRMY
DKITSNTQWLRETIAATV
Download sequence
Identical sequences B0WJ26
7176.CPIJ007155-PA XP_001848710.1.94360 CPIJ007155|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]