SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ007535|adhesive from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ007535|adhesive
Domain Number 1 Region: 884-1109
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-71
Family Eukaryotic proteases 0.0003
Further Details:      
 
Domain Number 2 Region: 736-845
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 3 Region: 587-698
Classification Level Classification E-value
Superfamily SRCR-like 1.2e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00068
Further Details:      
 
Domain Number 4 Region: 132-196
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000915
Family Tachycitin 0.0082
Further Details:      
 
Domain Number 5 Region: 236-289
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000133
Family Tachycitin 0.015
Further Details:      
 
Domain Number 6 Region: 698-737
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 7 Region: 547-581
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ007535|adhesive
Sequence length 1118
Comment serine protease|protein_coding|supercont3.178|57832|65776
Sequence
MQIHERWFSWLLVALALIVHESCGIYDPRTNGGPSFNMMPQVHGDYSKVHTHKARSYEPN
YARSDHGYQQQQQPFRYVPPTVPATTARVEVQPQKAAYRDLQAAPSYDGYGNENAILSAT
NSKLRPTAGEVPTNFTGLECPPSASGHFVYIMDCRQFLNCWKGRGYIQSCAPGTLFNSET
NECDHPTKVHCLTSNTMEGYQRLARLRKPKDPVKSAPLTQGGQDDFYGGTELVVRCPPDV
IGLREHPTDCRKFLNCNNGATVVQDCGPGTAFNRMMSVCDHIHNVDCNRYGNFIQHGPSS
PSNPDAEEIDVENVSYDLDIRFNGNDDDGYVTTTARPRIPLQVPKPIYQRPASSEVRPVY
AAPPNTTPRMNQANTRYNPQYYQPNVTPNARDLHSGTTPLPLSEALKLLLKPYIAPNSNV
TLNMTKVNSMMNQPGLEVIGLNPNKTSPYINSPSDINRQLSGQQPIYYGAPTYRPPAPQG
FQPSTFNRQHASPPYTQQQQQPQYFPVYRPTTTTRPAIAVRPRFDEGSPQWRPMATPPRT
TTPKADPCKDMFVCGNGKCIDPVKVCDGRDDCGARQDERNCDQVGYEVRLSGKHQGRVEV
KAYDKWGYVCDDSFSLGAAHVLCRELGFAGGALELKPNSFFPPNAALMNNGNPVFIMDEV
RCTGNESSLQECAFSGWGVHDCNAEEVVGVVCKTPAMTCPNDYWLCDTSSECVPVGFLCD
NVMDCADGSDESAEHCNAPLEMRLADGPSRTEGRVEVKYRGVWGTICDDEFGLREARVIC
RQLGLGNGTAQVRKNKYKVGTGQIWLDQVVCGGNETSIDDCMHWRWGEHNCSHQEDVGVS
CGTPPQTSAQLRLATGKSFKFDGERSAKIYPDSCGQLQVDPKAVKPTYGARVIHGGETVY
GHHPWQAALRAKRTGKSVHWCGAVLISKYHILTAAHCLIGFPKGAYMIRLGDYNTDALEQ
AENNDIADVLLKTPIRFNNYVQPVCLPAKNLPYHEGANLMISGWGSTQSGSSVHSLELRA
AKVPLLSDVTCTQPEVYGKNITAGMFCAGSLDGGVDACEGDSGGPLVCKNDRGHTLYGII
SWGSQCGYANKPGVYVKVEHYLDWIEEKLHQSLHTYGV
Download sequence
Identical sequences B0WLR7
XP_001849651.1.94360 7176.CPIJ007535-PA CPIJ007535|adhesive

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]