SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ008266|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ008266|conserved
Domain Number 1 Region: 161-469
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 5e-30
Family NodB-like polysaccharide deacetylase 0.041
Further Details:      
 
Domain Number 2 Region: 114-151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 38-99
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000186
Family Tachycitin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ008266|conserved
Sequence length 535
Comment hypothetical protein|protein_coding|supercont3.177|409359|418156
Sequence
MANVIKVIGFMCLIVAIAAVEYRVKRQDDDQDAEDNIEELCKDRPADEYFRLSTDGDCRE
VVRCTRSGLKQITCPSGLAFDIEKQTCDWKAKVKSCDKKEKPRKVLPILKTDEPICPEGK
LSCGNGECVDKELFCNGKPDCKDESDENACTVELDPNRAPDCDTTQCVLPDCFCSADGTR
IPGGIEPQNVPQMITITFNGAVNVDNIDLYEDIFNGQRQNPNGCQIRGTYFVSHKYSNYS
AIQDLHRKGHEISVFSLTHKDDPNYWTQGTYDDWLAEMAGARLIIERFANITDGSIIGVR
APYLRVGGNKQFEMMADQFFVYDASITASLGRVPIWPYTLYFRMPHKCNGNAHNCPSRSH
PVWEIVMNELDRRDDPTFDESLPGCHMVDSCSNIQSGEQFGRLLRHNFNRHYNTNRAPLG
LHFHASWLKSKKEYREELIKFIEEMLVRNDVFFVTNLQVIQWMQNPTELNALRDFQEWKE
KCDVKGQPYCSLPNACPLTTRELPGETLRLFTCMECPNNYPWILDPTGDGFTTKK
Download sequence
Identical sequences B0WLQ8
XP_001849642.1.94360 7176.CPIJ008266-PA CPIJ008266|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]