SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ008267|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ008267|conserved
Domain Number 1 Region: 229-268
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 349-425
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000556
Family PA1517-like 0.019
Further Details:      
 
Domain Number 3 Region: 55-99
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000012
Family Tachycitin 0.02
Further Details:      
 
Domain Number 4 Region: 116-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 185-211
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000471
Family Tachycitin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ008267|conserved
Sequence length 491
Comment hypothetical protein|protein_coding|supercont3.177|476191|502060
Sequence
MVKFIALIGALALVASATASVRTKRQSEGEKKEESFEKELCKDKDAGEWFRLVAGDGDNC
RDVIQCTSSGLQAIRCPAGLFFDIEKQTCDWKDAVKNCKSKNRERKIKPLLITDEPLCQD
GFLACGDGSCIERGLFCNGEKDCNDGSDENSCAGMRDDQTARQIFTPERKRNFALRYRLT
LGLQAIRCPAGLFFDIEKQTCDWKDAVKNCKSKNRERKIKPLLITDEPLCQDGFLACGDG
SCIERGLFCNGEKDCNDGSDENSCARAQLQPNLFTVDIQVDIQPPPTVGQLDGTVQPPAN
QTDNTNLTPRTALFRANVFEVSDLQDLLDTREYPTNDEYLPGCAMVDSCSNILTGDQFYN
FLNHNFDRHYEQNRAPLGLYFHAAWLKNNPEFLDAFVYWIDEILANHNDVYFVTMTQVIQ
WIQNPRTVSEVKNFEPWREKCVVDAKPACWVPNSCKLTSKEVPGETINLQTCVRCPNNYP
WLNDPTGDGFF
Download sequence
Identical sequences B0WLQ9
XP_001849643.1.94360 7176.CPIJ008267-PA CPIJ008267|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]