SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ009731|glucosidase from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ009731|glucosidase
Domain Number 1 Region: 435-533
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000000000249
Family Mannose 6-phosphate receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 226-288
Classification Level Classification E-value
Superfamily EF-hand 0.00000154
Family Calmodulin-like 0.07
Further Details:      
 
Domain Number 3 Region: 43-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000969
Family LDL receptor-like module 0.0042
Further Details:      
 
Weak hits

Sequence:  CPIJ009731|glucosidase
Domain Number - Region: 81-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00124
Family LDL receptor-like module 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ009731|glucosidase
Sequence length 548
Comment 2 subunit beta|protein_coding|supercont3.252|324206|325914
Sequence
MWSPRGKESGRLLLVLVLCSFGILVLTELPRPRGVSISRASLYPAGGGKFVCLDGKRTIR
WEQVNDDYCDCADGSDEPGTAACPNGVFHCTNAGYKPRNLPSSRVNDGICDCCDASDEYA
SAASCVNTCSELGKEDRLREKQRTEMAKMGQQMRAEMSQRGKSLKEEQRLRFAELEKSKV
EAEAIRDEKASIKSDAEALESVALKVYRDREEDARRVKQEQEAMSNREEAEETFRKYDSN
QNQLLEIVELQTRIAFDRNRDGAVTVEEAKYFLDEHDQVDLETFISLCWPKIKPFLMMDS
GLFKPPSDVDELNQEEAELQNEEDDRRYELDSSEPAHHYNEEEEEGTELEHEEEEDDEGL
DEPEVGEGQVQTEQPEEAPKVEYDPDTAELIRKANEARNHHSEADRHVREIDQEMRNIED
ALNKDYGRDEEFAPLNGECINYEDREYVYKLCPFDKAIQQPKNGGSETRLGTWDRWENAD
YTAMRYSNGATCWNGPARSVLVHLECGLDTRILSVSEPNRCEYEYRVQTPASCNLNADTG
KDQQHDEL
Download sequence
Identical sequences B0WS45
CPIJ009731|glucosidase 7176.CPIJ009731-PA XP_001851529.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]