SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ009754|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ009754|conserved
Domain Number 1 Region: 433-470
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.0011
Further Details:      
 
Weak hits

Sequence:  CPIJ009754|conserved
Domain Number - Region: 394-426
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000393
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ009754|conserved
Sequence length 507
Comment hypothetical protein|protein_coding|supercont3.233|283915|295756
Sequence
MSPLLYDKGSGHYYDTDLVFDDSSTIPSKASKPNTATNLVNDDEERLFDLGASNDQPAFI
SDDDIEAANDYDEDETPEEEAYENDEMRAIAAAPQDESQNWLVRSVHRIKRSIDNLLSGN
DKATKKPKKRKNPKKMVNGSKKVRDSDLIAGKKIGRKNPKSMEEKKSGKPKNVHRIQTGK
RRGHEEALRLKRQYDGLADDEDTLSGSGGPLEIESENAYKLTLTVMKPWRQALADKESTE
FKQVAREVAGTLHNLLSRLDDEANFIITVLKLERNPDSVGETFITFEINVDKHAINRQTI
DNVLRTSIEQGYGQFDMKGYSLISEDYADPGTDKSIDTDFESEKPFISERANTVSSVNLK
DNDDNIIVETETQPALPPSTHKNDPTEDLCRGDDKVRCGKTNVFICDIQRCDGQPDCPNG
EDEDPASCPENVRDCSDDEFSCDQERCIPKSKQCDSHQDCDDGTDEIDCPTEAPPARDKC
ANTGSNNCSANPTNPVSNRTVFKVKHE
Download sequence
Identical sequences B0WQT5
7176.CPIJ009754-PA CPIJ009754|conserved XP_001851069.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]