SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ009755|serrate from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ009755|serrate
Domain Number 1 Region: 2655-2861
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-37
Family Laminin G-like module 0.00039
Further Details:      
 
Domain Number 2 Region: 2909-3109
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.76e-29
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 3169-3344
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.57e-25
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 4 Region: 2006-2098
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 2312-2401
Classification Level Classification E-value
Superfamily Immunoglobulin 1.85e-16
Family I set domains 0.025
Further Details:      
 
Domain Number 6 Region: 1913-1995
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000109
Family I set domains 0.019
Further Details:      
 
Domain Number 7 Region: 1627-1713
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000254
Family I set domains 0.026
Further Details:      
 
Domain Number 8 Region: 1721-1812
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000032
Family I set domains 0.015
Further Details:      
 
Domain Number 9 Region: 521-604
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000349
Family I set domains 0.023
Further Details:      
 
Domain Number 10 Region: 485-523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 11 Region: 2503-2589
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000199
Family I set domains 0.036
Further Details:      
 
Domain Number 12 Region: 2087-2184
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000202
Family I set domains 0.034
Further Details:      
 
Domain Number 13 Region: 1822-1905
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000315
Family I set domains 0.035
Further Details:      
 
Domain Number 14 Region: 2597-2675
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000348
Family V set domains (antibody variable domain-like) 0.07
Further Details:      
 
Domain Number 15 Region: 442-479
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 16 Region: 400-438
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 17 Region: 43-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000113
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 18 Region: 2418-2501
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000135
Family I set domains 0.037
Further Details:      
 
Domain Number 19 Region: 1241-1284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 20 Region: 2850-2891
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family EGF-type module 0.012
Further Details:      
 
Domain Number 21 Region: 322-396
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000635
Family I set domains 0.047
Further Details:      
 
Domain Number 22 Region: 94-131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000314
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 23 Region: 2234-2316
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000758
Family I set domains 0.027
Further Details:      
 
Domain Number 24 Region: 910-952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000195
Family EGF-type module 0.093
Further Details:      
 
Domain Number 25 Region: 1534-1580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000428
Family Laminin-type module 0.03
Further Details:      
 
Weak hits

Sequence:  CPIJ009755|serrate
Domain Number - Region: 1205-1243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0035
Family Laminin-type module 0.059
Further Details:      
 
Domain Number - Region: 1574-1609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00516
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 957-1003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00774
Family Laminin-type module 0.097
Further Details:      
 
Domain Number - Region: 843-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0133
Family EGF-type module 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ009755|serrate
Sequence length 3710
Comment protein|protein_coding|supercont3.233|372740|445634
Sequence
MSSPALTEAVFPLNRSVMAYLIVSMAKMRKTVQQTHSPARNDRCGPDSFECHDGICIADY
KKCNGIVDCHDQSDELHCPYDFDVEDGEEEEEDNCTDDEFFCDGRCLDKRLQCDGRIDCQ
SGEDEENCPALRAVHKTILKSCRGPDEMASRAGRWTGLTLAVRCAGNRGVGVSVIASHPV
GLGSIPDGPDGIVRDEICLITPSVGREVSDALSMSSPATMAAASTLIGNVTGVRIATMEV
TSETVIITIPQQSAAHNTSVLMVPVLNIPSAVMVTETAEMVRMNTIVVPAQGRNSDVTPV
SAFRSPGGVTFGSIVPTVPTNTVACRDEGPIRAKVKWSRANGLPLPPGSRDINGRLEIPN
IRFDHNGDYICEAVGFPKSTPGGSKMVHLIVERYYPAERPPSACSITQATCMNGDCIAKS
QICDGNFDCVDGSDESGCRESQCEPNEFRCSNKKCILKTWRCDGESDCGDGSDEENCATL
PPDAACRYDEFQCRSGQCIPKSFQCDSHPDCFDKSDEIGCMAPSVIQPPPPSLSIQAGGV
LNITCRATGIPVPLIVWRLNWGHVPSKCNSVSDNGFGVLTCNDMQLIDSGAYSCEIINSM
GTHFVSPDTIVVVSGNDTVCRNGYFNSKARHPEECINCFCFGVSNQCKSADLYTYALNPT
VSSLTVVGVEGPWTGQRRITEGEFSNHDLTVTRHGVQLRLANIVPGRQVPYYSLPVEYKG
NQLKSYGGSIRYQVEYDGTGNPNTAPDIIVKGNGIILLYKHNAPFYPDERNAVSATFLPG
TWRKDDNSLASREDIMMVLADVESILIKMLYIEGVERNIELLDIAMDSAATQNLGLGSAT
LVEECRCPPGYRGLSCESCDFGYVRQSSGPWLGRCVPRAQECRPGYYGDPNRGIPCQPCP
CPVPGDKSRARTCSLDNYNNVICNCDRGYTGDRCQQCAPGYVGNPMGDGCFPGQVTNCNS
EGTQQVLPDGRCICKTGVTGTYCDRCAAEHFYMHEKGCVECFCMGISRSCTSTSLYRDTV
QATFNDGQSGFSLISDYANPEIIATNLPASSREIVYRNFGTSDDTFYWRLPAKFLGNKLT
SYGGFLNYTLRYTPHSSGGASRNNSPDVVLHSGNKIKLHHYRTDGSISPIGSSTYTVPIV
EDFWQNYEDGNKVLRPYLLMALANVSDIFIKATYNTVSNEAALSHVGLDIASENDYGSGT
RAWPVEQCQCSQGHIGLSCEDCGPGYYKGDGGLYLGLCEKCECNEHSDECDPITGECLNC
RHNTYGSNCEHCKPPYVGNATGGTPYDCTMDKPDSSFNCQHCDPRGSTVRCEGQCECKRL
VEGYRCDQCREGSFDLSAQNVDGCRECFCSGVTKSCSKSRFFREDLPLFISGDDGFTLTD
RDGHVLVTDNFDVAPNRNEISYNFRDRSTYYWSLPERLLGNQILSYGANLTITQSTVGSE
PSQDQDIILIGNGLKLFWTRPHYEDGTYSVPLLESYWKNVGSRGVYQASRSDLMTVLSKL
DHILVRATVRDYTTRSSISDIVLGTAVNVRTDYEPAEEVEVCRCPPGYRGTSCELCDDLY
YKDVFDRSAGITGVCKPCPCDNADSCEADSRGDVICNCLPGFTGPNCDNRGHEDHVTERP
PPPVIEVVVTAPTIQIVEVGSRIRLGCTARYIVSKHPIDVRWDRIGGRLPDRAYIESGTL
TITNVQISDSGIYVCQAGSGPDTANQRVTVTVEGGSSSRKPEVSLSEDVIDRDEFRSADV
TCTATGFPTPIVTWERMDNHPLSSNVIIEYGLLRFNSLRKSDEGTYRCSARNDIGESDKI
LHVYVRESRPSPTHPDHAYETVVINPDNYQGRSGEQITLTCVCQPRGQVRWAKTGEPDLP
RNSYIQNELLIIEHATAENSGRYTCTAIFPSGRERSSFVDVAVSPARPDFTSPRVKPLDN
KHAVTQGTDYTVICEASGNPQPTIKWTLSGKPFAPNVQQIGNTLRIVNAQPANGGVYICL
AENSEGMDRSYTVLDIDRRESPVLELYPTEPQVIKVGESTRLSCRATAGVPYPTLKWVRR
DRRPLSTRVTQDYPGVITLREVTLDDAGEYECRAENSAGSTSLSASIDVQLAPIITITPP
VEELKIREGDELSIQCTARGKPEPNVVIKPPHHQDTDPRHLSSYEGRGSANVHIYQAEVK
HSGTYECIATSTAGTDSRFITIQVDKKRGDLGPHDNDRDYEEPDRPIRPPPPYDNNRPHQ
PQPQPPYYDRPQQHTYKAILGERSELLCNEASRGARTEWRRADGRRLPAGSIPRDGQLII
ENTGHDATGLYDCVAHDIAASPTTIVQIMLQVIEPPRISFSPTMPMVVRSGETVTITCNA
TGEQPIHILWHGENMQYLPDRIRVSGQYLQFTQITQEDAGRYYCSASNRHGNVTKVAEVI
VNRNEMIPDIPSHGRVHEVYRGSSISLDCKLPDNHYYPGLTYHWSRLDRPLPYNVRTEDR
VLQLNYIRDEDAGRYECRMNYPNGSVAYDFVDVVIKAPQSLPILRLEPTVSYLRPGESVV
VDCSSSAGSHVPVSWQRLGGQPLPYNFRQDGNRLIIQDVTETDGGKYTCVCHTDDGLQYI
SDFELTVSPARQPETQRTSKVEYAERGSTVKLQCNTDIHPTSFHWSRDRGTFNADQNITV
PILTLTDVQAADAGTYICTARHNGQSVDVLTILVVNGAIPFFPQSPKSFMAFNKIDNAYS
KFNFEISFKPEKLNGLILYNGQRRPNGDYISVSLRNGFPQFKFDFNGQLVSLQPEKPIHM
GQWHTIKVNRVRNNGFLLVDDQAPVVFPDKLKFHGLNLDDNLYIGGVPNFANIPASAVEA
REGFVGCISRLVINGREIQLHQEAITNEGTTSCEPCADDPCKNSGVCLDTQSETGYSCVC
QDGYTGKDCRIEGQKCMPGTCGIGRCEETENGAECYCPIHKTGPRCQYTEHYTDDTLAFK
DGSYAAYDKFQTKRSAKFRFKADNLEDGVLLYAVENEKTYGDFIAIILKDGYVELRYSVA
GKIPPVILKSTVPIRVNQWHDVSAGRSRGGLAYLQVDEEPLLNEPKIGRATAIALKSNVY
VGGYDKSVLLNRAVSVSRGFEGCISNLEISGNTLNMIDDIKDSANLYNCGHQQNSIDNGS
ENDEDNEIDPCKPGYGGPNCDVIVDVCLAQRPCENGAVCHSKLNELQHTCECQTGFLGRK
CENMYATNIGSQFRGDGFLEIDPKAIAASADQYETKLAIMFSTTHYNGMLLWYGQRNGDV
FSGDDYISLSVHEGFLELGMRLNGEESTLRNEDVFVADGEQHVAVITREANRNRLEVDHF
SSHGETRPTRKQDIHLPGSIYIGGAPDLNRFTGDRFNESFNGCVYVIENPDTSRAVPLQD
FAIRTVNVDVCDDLISDQADSTAGGDSARQQVVQSGDSFQADGFLALKSRHEEEKSINLQ
NEENFRRYANPLKGSASSLRGAIELSLRPAPEINQIAAPNTLHRSVWLRRRRHRIIRRHP
RRDHGASLKDFGKWSINKCTAATPPATARTGTHRRRRPAIPSCTTAIEAGLFCQMKRIDS
FEPSPVRGACNGQFKKVNNEVAACCVLLPGYALLRYVCEIGETSLRYWKQCFLLTSANRD
LRFLEQIGSKVCDSANRILFRMCLIISSPRARNCSALLRQVRNRVNISPARDKNSGRRPR
WRTIAPIQEGTLSCPLEPYDDQLPARFRSYFAEEGGTLLLSSSFFSCSSR
Download sequence
Identical sequences B0WQT6
XP_001851070.1.94360 CPIJ009755|serrate 7176.CPIJ009755-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]