SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ010280|leukocyte from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ010280|leukocyte
Domain Number 1 Region: 1180-1486
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.32e-80
Family Protein kinases, catalytic subunit 0.000000375
Further Details:      
 
Domain Number 2 Region: 510-698
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-27
Family MAM domain 0.028
Further Details:      
 
Domain Number 3 Region: 292-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000222
Family MAM domain 0.0085
Further Details:      
 
Weak hits

Sequence:  CPIJ010280|leukocyte
Domain Number - Region: 465-502
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00275
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ010280|leukocyte
Sequence length 1775
Comment receptor tyrosine protein kinase|protein_coding|supercont3.262|263104|278950
Sequence
MPRSLLTPLLLATLLLILRSAFGQRPLGNATFGASHNSTGVINVLQTSTTGHPPTTPEEP
YYSEEEDDQHSPHDEHPYQHPPGIDGNLPGHISIASNQYAIAGGRVSDPLNSFSPSINDI
IASENNHLRPVNLNPVSDLVGKSRSINPFIPTPNPAQIGDSVGGAGPPGSFADLGGNRKP
FNPRRRPASSSAIHNLRKLNKNAAANAAATSGADSGIERANDGNSPRRLLGHGTVGMPMH
TPGHQGGPGSRRRPYDNVQGEDPLWQIRQKFQNEKYLNPIIYENDDMDRQLGVGCNFETE
CAWTWKHDDPQSFQVVTGANLTESNRTGMMPGPKADVLGDANGHFLHLRLTTNSTAQILT
SPMFGATRENCYLEVYTHQSMMAYGSLRIVIETVGSHESSWVPAEVMGNDLGKWLLNKFR
IDKITKDFRILFEVVPNRLGEHPRGHVSIDNLRMVNCFPDAISTNNCSFSQVRCTASKVP
VCIKTPKICDIEKDCDDEEDETLNCDKIPFGGRCDFESGWCGWQNYGNAILSWARHSGPT
PTEKTGPDMDHTHEATMENVTGYYMFVNMNQHANDSEKKTLVGLASNAIMNSVIFNPPPL
VHTNASSPYRNSCVVRFYVHQFGMNPGSINLSSVEIKEKENVTTTLWWSSKNLGEYWVRV
DIILPNITTKYYLQFEARMGMRIFSDVAIDDFSLSPECFGLNIPADDLQGYNYWDPRIGG
VKQPHKDFTGKSYLELNTCGAKGQHGPTPADCLTSYNGTEALNAVQVIDRQPFKGIQSWK
VPNEGYYTIIAKGAGGGLGSGGVGSSRGAMVLSVLELHKDEEIFILVGQSGEHACIKSMG
YRDETCEPKNKPPFAKDTLPMYTSKTQQVKNTVIEDGAGGGGGGTYVFLLNSANTAVPLL
VAGGGGGLGVGRYVDEDGQHGKKYIAGSKDVSGTAHSDHARHAGPGGGWRAQADMGLDPK
YGASLLEGGRGGLPCYPPRGAHGQGGFGGGGGGCDTGGGGGGFSGGDTMINSTNGQGGGS
FLASKRNVPELSMEQSGANSGHGAVLIIPAIQGCGCDYRCVALDEYRSMVGCICPDGWTL
KPDNFTACELQSETPEMQYLIVFFVVVVVILVAALASLILILYNRFQRKRQAALRHKMLL
EQDLQLSRLRSTADDTGLTNFNPNYGCDGILNGNVDVKSLPQVARESLRLVKALGQGAFG
EVYQGLYRHRDGDAVEMPVAVKTLPEMSTGQAESDFLMEAAIMAKFNHPNIVHLIGVCFD
RHPRFIVLELLAGGDLKNFLREGRNKPERPSPLTMKDLIFCALDVAKGCRYMESKRFIHR
DIAARNCLLSSKGPGRVVKIADFGMARDIYRSDYYRKGGKAMLPIKWMPPEAFLDGIFTS
KTDVWSFGVLLWEVFSLGLMPYTGLPNRDVMQLVTGGGRLDAPPGCPNAIYRIMADCWNP
TPEERPTFSNLLERLTTCTQDPEVMNAPLPSFFRPPSNERDTTIMRPPGNDDFCLQVPNS
SDYLIPLPGPRTVAERLLSEATGVTIPDTMVTCTPPKMASPRIINGQPQQLQQDGKCWET
SFIREQPTVVTSMASMPAVQDPTMLVDKLISLDTPQQTPTSIQPPISFSTPMTNGPVTGH
GHNGVVVMAHCNGGINGSPQLLANGTGPNGSGIIPPPPLVDQIDTAKILNSIPPPPITLD
PSTLNKQQAGVGGTSYANIRMINASSLNGGDHGEKMAGGRGNGGGGGGGNGGGSNHHHSN
SSGSDKSGENRPTAFTIQTFSDRYINNENHSEISC
Download sequence
Identical sequences B0WSM5
7176.CPIJ010280-PA XP_001870683.1.94360 CPIJ010280|leukocyte

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]