SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ010843|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CPIJ010843|conserved
Domain Number - Region: 160-202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0216
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number - Region: 122-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0726
Family LDL receptor-like module 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ010843|conserved
Sequence length 218
Comment hypothetical protein|protein_coding|supercont3.302|18557|19359
Sequence
MRKTWVKRDNIYYKPFYKQKLKMTLLGVLLMAFVFFGYQFFYISQLQTTESSLHTNPQTN
RHGSVVAASRRAVRVRREGWQLREADSAVSSWLLVKLRDFGRFTRFFRGIRLRDLDAYQP
GSSAAFRCLSSTRHVSWARINDDYCDCPEDGSDEPGTGACDRGRFYCRFQKRHATGRGGY
TSVPSGWANDGVCDCCDGSDEWLSGADCRNTCKERFPY
Download sequence
Identical sequences B0WUZ7
7176.CPIJ010843-PA XP_001860318.1.94360 CPIJ010843|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]