SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ011051|predicted from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ011051|predicted
Domain Number 1 Region: 173-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000156
Family Plant C2H2 finger (QALGGH zinc finger) 0.091
Further Details:      
 
Weak hits

Sequence:  CPIJ011051|predicted
Domain Number - Region: 3-67
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0328
Family Transcription factor grauzone Cg33133-Pa, zinc finger associated domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ011051|predicted
Sequence length 259
Comment protein|protein_coding|supercont3.341|14543|15442
Sequence
MDFCKLCQRKCSPFLIEWVNNSNSSEFVDAVESILRFRPEVANLTVCGTCWILVQLFGTF
MEGCRAIKNLIGPKQQLAGVGSANDDLWQSDETEKALDYSLRTVRNHVQRINSLGVDREE
SANDERSQLEETQSDSTITVLRICRKCSRIVGDRKEHALVCDAFSTADPKRTFYTCSICS
AEFLVRSHLQVHLNKHNRVKPYKCRKRCDTHFYGRVGRLNHEKTCKHAVRICFYCEVKLE
SARDFAEHLASDHNIVSFL
Download sequence
Identical sequences B0WWV9
CPIJ011051|predicted XP_001861881.1.94360 7176.CPIJ011051-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]