SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ011346|notch|protein_coding|supercont3.312|276280|301660 from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ011346|notch|protein_coding|supercont3.312|276280|301660
Domain Number 1 Region: 1150-1298
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.01e-23
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0045
Further Details:      
 
Domain Number 2 Region: 62-173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-22
Family Spermadhesin, CUB domain 0.00091
Further Details:      
 
Domain Number 3 Region: 2416-2626
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.98e-22
Family Laminin G-like module 0.047
Further Details:      
 
Domain Number 4 Region: 681-831
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-22
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0056
Further Details:      
 
Domain Number 5 Region: 178-289
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-21
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 6 Region: 290-406
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-21
Family Spermadhesin, CUB domain 0.00093
Further Details:      
 
Domain Number 7 Region: 527-598
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000542
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 8 Region: 903-968
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000278
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 9 Region: 3026-3175
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000589
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number 10 Region: 2057-2187
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000138
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 11 Region: 1740-1891
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000471
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 12 Region: 1912-1949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000822
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 13 Region: 20-58
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 14 Region: 2221-2264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 15 Region: 465-528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000528
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 16 Region: 581-645
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000128
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 17 Region: 2028-2070
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000404
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 18 Region: 835-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000019
Family EGF-type module 0.012
Further Details:      
 
Domain Number 19 Region: 2182-2226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000858
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 20 Region: 2334-2375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.015
Further Details:      
 
Domain Number 21 Region: 642-681
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000026
Family EGF-type module 0.015
Further Details:      
 
Domain Number 22 Region: 1039-1107
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000334
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Domain Number 23 Region: 404-476
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000347
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 24 Region: 2300-2341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000976
Family EGF-type module 0.021
Further Details:      
 
Domain Number 25 Region: 1991-2035
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000147
Family EGF-type module 0.01
Further Details:      
 
Domain Number 26 Region: 2267-2300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000164
Family EGF-type module 0.024
Further Details:      
 
Domain Number 27 Region: 1951-1994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000351
Family EGF-type module 0.019
Further Details:      
 
Domain Number 28 Region: 2958-3049
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000968
Family Growth factor receptor domain 0.006
Further Details:      
 
Domain Number 29 Region: 2375-2415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000347
Family EGF-type module 0.052
Further Details:      
 
Weak hits

Sequence:  CPIJ011346|notch|protein_coding|supercont3.312|276280|301660
Domain Number - Region: 1103-1148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000153
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number - Region: 3231-3270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0014
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 1494-1525,1573-1579,1711-1785
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00141
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number - Region: 3199-3236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0164
Family EGF-type module 0.059
Further Details:      
 
Domain Number - Region: 2737-2792
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0788
Family Complement control module/SCR domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ011346|notch|protein_coding|supercont3.312|276280|301660
Sequence length 3418
Sequence
MACQAVFRIVLLATIVTVTVAEACPQNTVRCSNGACVNQAFKCDGNDDCGDGSDELDCPN
ACHFHMQSGGDVIESPSFPQKYPALANCKWTLEGPQGTNIILQFQEFDTEKNFDIVQILV
GGRTEDKSVSLATISGKSDLASMPFITASNFMIIKFTSDGSVERKGFRATWKTEPQTCGG
TLQATTQGQILNSPGFPKGYPGGLECLYIIKGQNGRVISLEVLDLDLNDERDFILIRDGE
NAHSKPAARLTGSAVNDHNKVIISTGNKLYIYFKTALGESKRGFRIKYTQGCGATITALN
GTVSSPAYDLSNYPNNQECFYRIKNPNGGPLSMRFERFNVHNSDKVQIYDGSSTSGLRLH
PGDGFTGNSVPKIILTASSGSILVKFNTDALHNDKGWLAEFSADCPKLKPGIGAVASSRD
TAFRTTISFVCPTGQEFATGKNKIVTTCQNGGTWSVDYIPKCQEVYCGPVPQIDNGFSIG
STNVTYRGVAMYQCYAGFAFSSSNAIEKISCLADGKWERQPSCLASQCPILPEVAHANVT
IFNGGGRSYGTIVGYECEPGYQRNGQPVLICMSNGTWSSSIPTCHRKRCYNFPEIENGFI
VDQTRQYYFGDEARVQCYKGFKQIGSNIIKCNDEQQFDSLPACEDINECLASPCDSASTE
CVNTPGSFYCQCKGGFTPSTDCRPVGDLGLATSGILDKSIMVSATEEGYNKAMLRLNSAG
WCGSSVDPGSNWVLIDFKAPTIIKGFRTMSVQRYDGSLAFTTAIRIQYTNNMTDVFKEYA
NPDGTAVEFRILEPTLSILNLPIPIEARYVRFRIQDFAVAPCLKLEVMGCTRIDCVDINE
CAVQNGGCRQKCINSPGSYSCGCNTGYELFTNNGTAGFFIDANETGERDGDVYQRNKTCV
PMMCPPLASPENGQILTENTEHHFGEVIQFQCNFGYVISGSTSLLCMSTGVWNATVPSCI
YAKCVSLPDEKNEGLVVLRQDQNSVLVPFRENVTLTCNAPGRILRKSITSGFRQCVYDPK
PGYPDYWLSGSVPSCPRVDCGDPMPTPGAEYGQRSDTRFQSSFFFGCQNTFKLAGQSAKH
DNVVRCTENGIWDFGDLRCEGPVCEDPGRPNDGYQVTKSYEQGSEVLFGCSRPGYILINP
RPITCIREPECSVIKPLGLSSGRIPDSAINATSERPNYEAKNIRLNSVTGWCGKQEAFTY
VSVDLLKVHRIKAILVKGVVTNDIVGRPTEIRFFYKQSETENYVVYFPNFNLTMRDPGNY
GELAMITLPKFVQARFVILGIVSYMDNACLKFELMGCDEPAADPLLGYDYGYSPCVDNEP
PVFQNCPQQPIIVKRDQNGAILPVNFTEPVAIDNSGSIARLEVKSPSFKTPSFVFQDTIV
KYIAFDYDGNVAICEINITVPDITPPSLSCPQSFVIELVDKQDSYLVNFNETRKRLKVSD
NSGDVTIEYIPESASIPIGAFENVTVIATDKFNNKAMCNFQVSVQATQCVDWDLQPPNNG
NINCRSNDKGIECIATCKPGFRFTDADSVKKFSCETKRLWKPSSVVPDCVSENTQQADYH
VTATTIYRANGAVSKSCLSQYQELLSQYYPNLNNILSQRCSAVNVNMNVSFLKSVPKLLE
ENMIQIDFILSILPAIKQPQLYDLCGSTLHLIFDLSVPYASAVIEPISNVSAIGNQCPPL
RALKSSIARGFTCSAGEVLNMDTNEVPRCLHCPAGTYAGENQQVCTPCPKGYYQNRDRQE
SCLKCPAGTYTREDGSKSLNACVPVCGYGTYSPTGLVPCLECPINSFSSEPPTGGFKDCQ
ACPTNTFTFKPAAQSSDQCRIKCPPGQYSPTGLAPCSPCPKNFYQNIEGMLTCNECPTGM
KTDGSGATRQEECKPVMCNENSCQHGGLCVPMGHEVQCFCPAGFSGRRCEIDIDECASQP
CYNGGTCKDYPQGYKCMCAPGYSGINCQEEKSDCGNDTCPSRAMCKDEPGFNNYTCLCRS
GYTGEECDVTIDPCTSSGNPCKNDASCVALQQGRFKCECLAGWDGQLCEINTDDCAENPC
LLGANCTDLVNDFSCACPNGFTGKRCQDKIDLCLPEPCNHGMCIDRFFYHECVCQPGWGG
ESCNININDCASDPCENNGNCIDMIDGYQCNCEAGYTGKNCQHFIDDCASNPCQNGASCV
DQLDGFQCKCRPGYVGLQCETEIDECLSDPCNPSGTDKCLDKDNSFDCACRDGYTGELCE
TDIDDCASAPCLNGGSCQDRIGAYECKCAPGWSGYQCEHLIETCEPAHPCKNDARCIDLF
EDYFCVCPSGTDGKQCETAPDRCIGEPCMNGGQCKDYGSGLNCSCSSDYIGIGCQYEYDA
CDDNICKNGAQCIDDGSGFKCICAPGYTGEKCDQDIVDCKDNSCPPGATCIDLNQGFFCQ
CPFNLTGDDCRKTIQVDYDLYFSDPTRSSAAQVLPFYTGAPDSFTLALWVQFAQKDDTGI
FATIYAVDSAHSTNDRRVILQAHSSGVQVSLFPDQQDAFLGFREYATINDGQWHHVAIVW
DGKTGQLQLITEGLIASRAEYGTGRSLPAHVWAVLGRPAVASNETNNVAFNEAGFQGKIT
KVQIWSRALDVTSEIQKQVRECRSEPVLYRNLILNWAGYEDSIGGVERSVPSSCGKKVCK
SGYAGSQCKQLENDKEPPKVERCPDDLWIIAKNGSSIVNWDEPQFSDNVGITKVIERNGR
RSGQSFLWGGYDITYLAFDAAGNTASCSFKVTLLSDFCPPLADPIGGSQNCKDWGAGGQF
KVCTIACNAGMQFSSVIPEFYTCGAEGFWRPTEDPLTPLVYPSCAPARPAQKVFRIQMLF
PSDVLCNEAGQGVLRQKVKNAVNSLNRDWNFCSYSTEGSRECKELQINVKCDRYSHSSNI
VKRQAVKPFTKQDSSTYVIDATIPIKGDPVLHSSNGERSTVRALLEKLILEDNQFDVQEI
LPNTFADPASLALTSEFTCPVGQVVQEPNCVPCAIGTYFDTTSKTCVSCPKGSYQSEIGQ
LQCKSCPNIAGRSGVTSIIGARSAAECKERCPAGKFLDSETGLCQPCGYGFYQPNEGSFS
CEICGLGQTTRITEATSKSECRDECKSGMQLGVAGNCEACPRGTYRTQGVQPACTSCPTG
RTTLKVGASSIEECSLPVCLPGTYLNGTVNVCIECGKGFYQPEQQQTFCIPCPPNHSTKT
SAAKSKEECTNPCANVSEGQQHCDPNAFCILMPESFDFKCECKPGFNGTGMQCTDVCEGF
CENSGQCVKDIKGIPSCRCKGSFTGTKCSERSEFAYIAGGIAATVIFIILIVLLIWMICA
RANKRRDPKKILSPATDQTGSQVNFYYGAHTPYAESIAPSHHSTYAHYYDDEEDGWEMPN
FYNESYMKEGLHGTNGKLNSLARSNASLYGTKEDLYDRLKRHAYPGKKEKSDSDSEVN
Download sequence
Identical sequences B0WVE3
XP_001861365.1.94360 CPIJ011346|notch|protein_coding|supercont3.312|276280|301660 7176.CPIJ011346-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]