SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ011799|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ011799|conserved
Domain Number 1 Region: 372-481
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.31e-18
Family Frizzled cysteine-rich domain 0.0013
Further Details:      
 
Domain Number 2 Region: 715-753
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000011
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 485-522
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 524-564
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000107
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ011799|conserved
Sequence length 766
Comment hypothetical protein|protein_coding|supercont3.365|218709|231623
Sequence
MQIWYGTPYSGYTTSSSPTQNCPNSSAPNSLPSHLHTSRQSYNFWKASGSQSPLTSASSI
NSFFRPSVHSRGCFRRTLHQIWRFLKWPLGLLLICSLLGLVVYFLVVDRDIMSSSLLGNG
DVYNVEENLSIDFNDFTHTNDLDSGPVTTFGRDHKDNAIGFSKDGATPNSKFSFGLNNDL
LAVLVKKTNNGEGQNTFWTSTSTEHESLSEETPAQVVKVLSSTTTAPVRKTSTISLKDYT
KGRVQFDEDEVFEVPADEHTTRAIDDVHHHHDLDGGIQVGGPNLRGMPLRSFGFTSGHQN
SFGVPIEEDERLLKMLNEQLLKLEKQRERNLTSASSSTTGITTSTTDSSLYRTKVSPTLP
ILSRFEITTEGICKSTSLPLCRGVLQYDLTNSSNRRLTNVEYEHFQYLINSKCSVRVAEF
VCLILEPECRPTRMGTLAPCKRICKSILEPCAHIIASSEVLTATFDCDAYPDSNDRAVCE
DPTRHSKCYANEFQCADSSCIPLQWKCDNIKDCQSGEDESDCKFCERDEYRCLSNDKCIP
DKWRCDQYEDCPDASDELDCYYDEPTTYPTAFGSQREYPFVQVQVPNSPVNGKPYLTITN
EDRERNLHQQDQQQDKSGGQQRHYPDYDSSREDDEYEPTAAENVPQINRRNRTETVESRT
ARLEDQTEAETTRTISVPKSLSNFQDSKEIMMTSDSENDFRYSSTSRAFLTTAHASPCPE
GELRCVSGICISVSQLCDKVTDCPDGADEAMCVYKDETTEQSPSKE
Download sequence
Identical sequences B0WXZ1
CPIJ011799|conserved XP_001862263.1.94360 7176.CPIJ011799-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]