SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ012499|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ012499|conserved
Domain Number 1 Region: 46-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000135
Family I set domains 0.055
Further Details:      
 
Domain Number 2 Region: 16-47
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000628
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  CPIJ012499|conserved
Domain Number - Region: 342-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000117
Family EGF-type module 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ012499|conserved
Sequence length 401
Comment hypothetical protein|protein_coding|supercont3.379|127784|129165
Sequence
MEYALRLSLQLALFGNGWSVSETFRCDSFRHCLDGSDEQGCQEAQFVQLPPENVTLTVGD
LLNLTCVASGVPAPSIDWKMNGKLPGGDCDWSTEGGVGQLSCRLRLIDAGNYSCTARQPS
RREIESRGTMVNVTGNACREGFFSESGKRKLCLKCFCSGVSTLCQAANLYRWNYTMAMND
WKMKYAAVMFSNDTQHLDIKSYDKFETNFTPYYKLPYRFKEYQVGSYDGNLQYEIQVDNT
SYSKDQPDIILQGYNATLFYKYKTPLIPGRSNKVVLRIHESNFRHQDGKKASRDDLMIVL
AYINLFLIRMYPTNGTYAPSSTDIVMDSSTDLGYHGLGKMDRIEECRCPHGYRGRSCERC
DFGYNRANRYLATGICMPWEWHREEYYKVSTSTTMRNYHYV
Download sequence
Identical sequences B0WYK2
XP_001862474.1.94360 CPIJ012499|conserved 7176.CPIJ012499-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]