SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ013117|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ013117|conserved
Domain Number 1 Region: 334-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000231
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 2 Region: 381-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000318
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 279-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000521
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 11-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000257
Family Transcription factor grauzone Cg33133-Pa, zinc finger associated domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ013117|conserved
Sequence length 464
Comment hypothetical protein|protein_coding|supercont3.433|83311|85442
Sequence
MERPKREDFDKICRLCLKSASLVNIFDRNPKTQQESLSTLVRETVEMLGLTIDPDDNFPR
KMCLPCKDSLRSLYKFRNQCQEANDLILEVLSSFELTVAQEVPSKLTVSVPEVQPKLSEE
FISVKATSTLIKEDIPAIDDHDEPVELSEQMVLEADSSSALNVSIVKSEAPSTVTVSEEY
EYLEQESEPDDGERDGKVEEMEANAGQDVYTIEMQADEAEEEREDGGGDVQNFEVYLEEN
SGSDEEEEAKSEDQSEQLQVATVKRGSVKGQLCTICNKYSTCLKYHMMYHTGERPYSCPH
CEKSFRTSTKLKIHVDGVHLKLRKFTCEVCNKKFLDAGNLKSHMATHAETRKYVCDYENC
GKAFALPGTLRVHKLTHTQDKQFECSFCHKSFLYKWLLVKHERSHTGEKPYECEVCHKRF
STSTHAKTHQKIHDPFREKPAKTSRKKKRQAGEESDDAVEVVVS
Download sequence
Identical sequences B0X0T6
7176.CPIJ013117-PA CPIJ013117|conserved XP_001863258.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]