SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ013362|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ013362|conserved
Domain Number 1 Region: 337-632
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.74e-57
Family Eukaryotic proteases 0.00077
Further Details:      
 
Domain Number 2 Region: 139-181
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 14-52
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 215-282
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000612
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 5 Region: 103-141
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000103
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 6 Region: 51-89
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  CPIJ013362|conserved
Domain Number - Region: 305-352
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0197
Family Complement control module/SCR domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ013362|conserved
Sequence length 640
Comment hypothetical protein|protein_coding|supercont3.505|76630|82657
Sequence
MTLPFSAFFRDRRKVCNYYEWKCASGQCIESHRLCDGVVDCKDKSDETSGTCAFIRCPSY
AFRCQYGGCVDGTAMCNGVKECADSSDEHLHCPGYSEALVTQGNCSNTEFQCQSGQCISS
DGVCDGTSNCDDESDEQQRICSLIFCPSFSFRCSYGACIGGYSKCDGVVDCRDGSDEDEL
LCGKPFPVTTPRIVSTSTTTSTTTTTPAPEIGPEGSCQVPPKPTNGRIVLDETAQNISIN
SGEYIENFNSVFVICDDKYTIKGAATIICLDGIWLDPFPICERYCSEIPINGITVQPTCE
YQRKQVTCKRPLPPSTKARIDCKIGYQKPAVPINETLTCTDGTWDSSVFRCEPVCGTPTP
DAEAYIIGGKNASIAEVPWHAGIYRNLENDTRDDLKSDDWDYICGGTILTERLVVSAAHC
FWDVTTFHDVRSFVITVGKYRRGLNTIETLPAQVLRVRELITQPQYQDFSGYYNLDIAIV
VLSDFIVFKSYVRPICLERNLRTESEKRIKPNSLGRVAGWGLTTSGGELSPNLKVVDIGT
VDYYTCRDFSPVSYRPFLTGDKFCAGDPKTGTSVCQGDSGGGFALGRDISGETVYFLYGV
VSSAPRSASGSCDNNKYVAFTEVQNYIPMILDAESRFPVI
Download sequence
Identical sequences B0X3L4
CPIJ013362|conserved XP_001864236.1.94360 7176.CPIJ013362-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]