SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ013661|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ013661|conserved
Domain Number 1 Region: 11-57
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ013661|conserved
Sequence length 64
Comment hypothetical protein|protein_coding|supercont3.473|52468|59956
Sequence
MELSGFVAEECPPAMDGMERFACPTPDRQGRYRCIDDHVLCDGFIDCPEGEDEDRQACMF
YKTF
Download sequence
Identical sequences B0X2B8
CPIJ013661|conserved 7176.CPIJ013661-PA XP_001863790.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]