SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ014258|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ014258|conserved
Domain Number 1 Region: 29-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 65-110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ014258|conserved
Sequence length 120
Comment hypothetical protein|protein_coding|supercont3.542|134967|139101
Sequence
MTPNVATIRSVIYSWFEEKTSTFRNESDVPCPSGTFRCSEGKCIPQTSICNYQKDCEKGE
DELNNCPPPECEQGQISCGQYVFNKTYCIPPHYKCDMTVDCVDGTDESDCSKYLYQSLLY
Download sequence
Identical sequences B0X4U3
XP_001864665.1.94360 CPIJ014258|conserved 7176.CPIJ014258-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]