SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ014519|low-density from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ014519|low-density
Domain Number 1 Region: 691-948
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-52
Family YWTD domain 0.00000415
Further Details:      
 
Domain Number 2 Region: 1289-1539
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-46
Family YWTD domain 0.0000176
Further Details:      
 
Domain Number 3 Region: 402-638
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-46
Family YWTD domain 0.00000296
Further Details:      
 
Domain Number 4 Region: 998-1234
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-39
Family YWTD domain 0.0000295
Further Details:      
 
Domain Number 5 Region: 295-354,639-685
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000753
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 954-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 257-291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 8 Region: 1243-1285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000132
Family EGF-type module 0.019
Further Details:      
 
Domain Number 9 Region: 203-242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000327
Family LDL receptor-like module 0.0025
Further Details:      
 
Weak hits

Sequence:  CPIJ014519|low-density
Domain Number - Region: 1548-1585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000141
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ014519|low-density
Sequence length 1753
Comment lipoprotein receptor|protein_coding|supercont3.575|91841|127277
Sequence
MATLSTLLLVAGVALCDEDTTPHPLVDDHYWRHSQPILFPGANQFGGPPSRPYAYNPAAG
KLKFDGRLVKAQKQNPNSKSKANGGGGGGGGGGNGRTPLPHGRIKMAPGPIPIGQEIPNG
PGDLRNGPRRPVPPVYGTGGGFGTLSHGLSRPVGGERTEGNPRMHNGYEYGGSLDKVFVP
EGDLLAGGAGADNSPGVDNCDIQCEPKEFKCEKSCACVHMDLHCNGQADCILSEDEQNCE
AVQQELMARMKESCEASGTHMICATSTTCISKEWRCDGDDDCGDRSDERGCGTAHQCTEN
KYQCANELCIPREWVCDGDDDCTDLSDERNCSRQCTADEFRCHDGSCISAAFECDGEADC
IDESDEGAAPGSATEPPTASAARTSRTATSSANGTSLRVRPQFTSIVKGLPNAIALDYHY
QKDLLFWTDVSIDVIKRSYINGTGVRDVIKWGLESPGGLAVDWIHDLLFWTDSGTRRVEV
STFDGKLRAVIAANDLDKPRAIAVHPGKTTVFWTDWGTVPKIEKSYMDGSERQTIVSESI
FWPNGLAIDYTTNRIYWADAKHVIESANFDGKGRKKILSNNLPHPFAMTLFEDSMYWTDW
HTRTVSSANKVNGRNFRIVQEGLHFPMDIQSYHPSRQPEYINRCAQDSSGRRGGCSHLCL
PNRNHRRCACPIGLTLKPDQRTCSNQPDKLLLISRKKDIRVRQLDQQNPTKGVDMVVPLD
GIKSNVAIDWCSQSNVIYWTDVGKSIISRAFINGSQQEAIIKSNLISPAGLALDWITDKI
YWTDAGTNRIEAASTDGRQRALLIWERLDKPRDIVVHPSEGFMFWSDWGSNPLIERAGMD
GTGRVTLVSENLQWPNGLALDIDSHKLYFVDGGTKLLEYVNFDGTGRNRLITEGLKHPFG
LDVHDRKVYWTDWDTHSIQVADKITGKNRDTILANNTDLMDIRVFHRTRKDVRNPCGSRN
GGCSYICLLNPSGYSCACPIGIQLNDNGKTCKDGPSNYLIFAHRTDIRQVSLDSDYQIDV
VLPLPPISNAVALDVDARTGDVYWADTIEDVIMRSSRTDAHQHLCDSIGRKIYWATRECS
IECSELDGSVRTVLVWHDLDHPRGIALDYDMGYLFWSDWRKDPVIERADMDGERRKTIVT
TDLGYISGLAVDGHEKRIYWTDSKSKKIESCDMNGNSRKVLLENIPHPHALAVTRGMVYW
TDWMTKALHSVSKTNISKIKKVAKDLENLMDVKVVLEQEEYTEDACGKNNGGCSHLCLRK
PKGYSCKCPTGLLMRETGGKECKTVPDEYLLVALRSGIGRISLDTQDLFDVVLPIDGVHG
VVALDYHFDRMYIFYADVNVDAIRRVSMNNFSDSKVIVASGLNTPNGIAVDWLADNLYWT
DAALKKIEVSRLDGSCRKAVLTGGLDDPRSIILYPKRGFMFWADWGQAPRIEKAYMDGSE
RRSIIDSELGFPTGLAIDFDMKKLYWADAQQDRIEMCDFDGKRRTRVISQATHSFGFTLI
GGYMYWTDWHNKSVLRAPKRVAAPVEEVRFGLRGALEIRSVSGSRQPHDINPCAKDNGGC
SHLCLFAETRYVCGCPDIPDDETHCRLEPAFNVPILTNDEITPTMDEEKPAKSNGSTMLH
SKNKIHAQLVIIAIAIVGGLLIIVVIAILVLIVNSKRKQSKKTSRSGSDVLTFTNPNYNG
VVEGMCHHPGSAGSEGSGGGGGNTIWKRLKYDGAQDRVYEEKYLGLPHGTATTTLISPAS
SSQISSTSAVLPV
Download sequence
Identical sequences B0X5M6
7176.CPIJ014519-PA XP_001864948.1.94360 CPIJ014519|low-density

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]