SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ014796|transmembrane from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ014796|transmembrane
Domain Number 1 Region: 1012-1206
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-46
Family Eukaryotic proteases 0.003
Further Details:      
 
Domain Number 2 Region: 712-820
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.7e-29
Family Frizzled cysteine-rich domain 0.00027
Further Details:      
 
Domain Number 3 Region: 844-880
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000119
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 882-919
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 916-1024
Classification Level Classification E-value
Superfamily SRCR-like 0.0000759
Family Scavenger receptor cysteine-rich (SRCR) domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ014796|transmembrane
Sequence length 1209
Comment protease|protein_coding|supercont3.603|240719|245754
Sequence
MASSFANCSYAPEANVGVDGTAGFNYSSDDRDKRTTRTGSLTNHSLLNLLEQKHKLLEAI
NLAPAPKVTVGRRHSSDSFPMIENESFQIPQRQIKKPPGLQLIPPPVPKRTFQGKFTHRQ
SESFDAPQSRASNVNLDGYGQPKGYGSQYRPDRICQSAFDEQTFGFFAPSKTKNIGSCHS
SVSTTSFDDLGDTDDFVIFNKKMSSIESNRSSSDSNKSQTTIDTGYVSANENDRSIFTTA
SSTKGTFRSRFSSEDTQSSLDSFLSSELHRTDTIDSLQMNDSPFSLKKNIFNFDSKSGQM
RHSTSISPNSTDDKMDNCSPRSVESKSARRLPMVPTRKQNNMPPKIPPPTRITPPALPSR
SQQAFESRKMQKLHHHQQQQQQLNNAQLTHKASMDNIQELYSRPTGFRRNMQKPPPLNQV
HHSKVNQRQDSNISSDGFSIASSPGYNNKNMEAPLLQHTSKMNRSTMRGHALQPKQLPSP
QQQQSPQQQLQQSPVNPQDSKQSSTDSLNPAAVTTVRSIPPRVSMRQDSSISSDSFSQTS
SPSYNTKIMEAPLLSHAAKMHKVAKPPAVAAAAARNLDEISKDVKDGGESAANGSAVIIK
SASTPASLQTIVRLSNGSNVSLQGKKLQILKSRKSSEASQANSRMKFRVCQIVINAILLI
ALAVGLASYLSQNPPITYVNQTNIVRTIHHRPPPIDSTAISPFKVDRNPAPGVCLPVIVK
FCQQHKVPYNYTVFPNYIGHFGQPEAQMEIDQFEALVDVQCYELVPLFLCSLFVPKCGAT
GTTVPPCKSLCTETMRRCSFFFDVFGLELPEYLRCNIFSDAVSVEQGECVGMAEYKESML
RSRRPVKCSGFLCDKRRCIPNDWRCDGHVDCQDQTDESHCDFCGASEIHCGSGKCMSQKH
MCNGVQDCPFGQDERNCIRLSERNGDLGRGTLEVYKADLKQWTPACVKNWDPATSPTMIC
SMLGYSSVNSSRTTMRGSNRTLVSTKDASLMWRMFQKKHTNMLKEFNSCDVNTRYPVAEL
TCSNYECGKVPNKKYHKPQTRIVGGSPSKPGDWPFVAAILGGPEEIFYCAGVLIADQWVL
TASHCIGNHTMRNVNDWTIQLGITRRHSHTYYGQRVKVKTVIPHPLYNLYIPHDNDIALF
QLATRVAFHEHLLPVCLPPPHIRELVPGTNCTVVGWGKREDSYVSYTVRYLRKFESQSGY
REECRKKGA
Download sequence
Identical sequences B0X6J1
CPIJ014796|transmembrane 7176.CPIJ014796-PA XP_001865263.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]