SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ014965|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ014965|conserved
Domain Number 1 Region: 57-151
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000916
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 2 Region: 159-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000877
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ014965|conserved
Sequence length 221
Comment hypothetical protein|protein_coding|supercont3.615|136|22533
Sequence
MSKQKVFSWPNRKKRTSGAIYDDEGCRIEVSGLHEGFLNRTDVPREKEQTVVEHALSLDC
MWVVTVPDGWKVSSRQTIQLSFLKFKLEKPNDCESNFVDVFTERTDLPSRLKNFCGSIAD
SVVSKSNVLHIRFFAEAAAINSTFSILFTAFREKAAGETCDDDEYDCEDATCISADLRCN
GRINCRFRWDEDECQVRGERCGGGFVGNYGVCLVRVGYLDC
Download sequence
Identical sequences B0X6V8
XP_001865380.1.94360 CPIJ014965|conserved 7176.CPIJ014965-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]