SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ015677|predicted from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ015677|predicted
Domain Number 1 Region: 24-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000144
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ015677|predicted
Sequence length 68
Comment protein|protein_coding|supercont3.713|179417|189504
Sequence
MSRNVTFAANTRLVGNNTTRMNGTLQCSERQFRCNDGHCIHVSFICDGDADCADASDEHP
RECKITEL
Download sequence
Identical sequences B0X989
XP_001866211.1.94360 7176.CPIJ015677-PA CPIJ015677|predicted

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]