SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ016829|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ016829|conserved
Domain Number 1 Region: 563-600
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000288
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  CPIJ016829|conserved
Domain Number - Region: 287-386
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000733
Family Spermadhesin, CUB domain 0.02
Further Details:      
 
Domain Number - Region: 28-64,104-142,175-240
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0288
Family Spermadhesin, CUB domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ016829|conserved
Sequence length 665
Comment hypothetical protein|protein_coding|supercont3.870|48596|56880
Sequence
MQHATFLQVSVKFVDLQSPTYAKSKRICEFWLRGTGHGVLQNPQHSLAPNTTCLYHLQVG
IHHRKFGIQNWAESVQGTEARSLDAINIPRRSGAFSTSPTRFKVWISVMKFELASPFGTV
DDQQLQFQTKEDCSGMLRIWDGPLREVPVCKDIDCLTVDKDGHQRPMVRFGQNSTNVIAR
FCRGSVPRSCDHGMLNMSSSRPCTLSESFVSSSDFVTLELKTTESTVLRPLQFALKYEFV
DFLQDGVPFAGEHDCNRRFSSSQIEKKGVHPVRSVRNIFLFGRGGAKHLHCIYRFEAQRG
ERIRLEVTRAMTGNRTCDSRVDPDTGRSYCFGDPSAKIEIFERPWHESIVFPRGCICNST
NRSFLPIVFSSTGREVEIHFSAGNMTALDDPDTLNFEATFEFIKAPVICKDVRRKNAVTG
IVKLSAGEMECRNRPWLIEPSHEKYLYVRLRGLLLRKNNPAVPLEYNTSLSTVTPIRCPT
KARVVITNSEGVSVTACPLPDDTSHRHVVEVFSAGWTRKHPHFGIEPSKVISVEFLQPDN
GAYSFSWLELTKRPAKSFALTVAEECPFQCPDLNACVNESIWCDGIAQCPSGEDESFTHC
SALLQLPAEILAGFSVLLLLLCCGLTAYLYRKIRRNCRRTSVLQTRLKSLSSMDTAVFDE
KEVIC
Download sequence
Identical sequences B0XCB7
7176.CPIJ016829-PA CPIJ016829|conserved XP_001867289.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]