SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ017507|low-density from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ017507|low-density
Domain Number 1 Region: 168-440
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-43
Family YWTD domain 0.0000268
Further Details:      
 
Domain Number 2 Region: 16-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000105
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 58-94
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 103-140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000101
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 5 Region: 498-531
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000113
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  CPIJ017507|low-density
Domain Number - Region: 444-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ017507|low-density
Sequence length 728
Comment lipoprotein receptor|protein_coding|supercont3.985|147335|154752
Sequence
MSDEIGCPPRFPGGRYCPESRFQCANNLCVSPSDLCDGTDDCGDNSDEAASVCTNFNCDT
LRRFQCANHRCVARYQICDGVDNCGDGSDENNMTLCATRQKSCDSYTQYQCANKKCIDRA
QICDYADDCGDSSDELGCHHTSTCSVMNKGGCEHHCMNLTDALKDDVLVVFSSGPEIRAY
DLKVNDQFDVIGGEKRIEAIDYNPETQMIFWADSYDKTIKRSYMINALNGEAKIGYAQDL
NMKGNSKPTALAVDWVADNLYWAETDRTGSKPRGRVMVAKTDGRYRRALVNAGLEVPTSI
AVDPQLGRLFWADAGSAPKIEVSWMDGSKRRPLITEAIRHPAGLTIDYSQDHMVYWVDTK
LNTIEVMKPDGSMRKAILKGEMLKHPVSLDVFESYLYWITRDTGELLRQDKFGRGVQVAV
QRSLANPSSLKVYHDLRYNTSLNNPCFKNPCTHLCLLVPGGRRCSCPDNTVQQTSHRSTA
EVVCDAPVERIRPSPRICPCQNGGQCREDDTGNELVCVCLAEFSGAHCEFYSERMFGSSP
GSAAAIYIPILVAILIAATVGLYFIIKKRPFGKPSLTSSQSVSFRPGTNVEFNSPDFPSN
RPPTGVIPAGGGVAPLDGYSLDTLGNKTTDFSNPMYDAVQSGTTADPGGVGNGSGIYEVP
SDVSAKGGKGGAPSSGPFVEPVSAILAPSSITHRTSPQLHLRPKELSPSSHDTGRDTQLL
VEEDKSEC
Download sequence
Identical sequences B0XE17
CPIJ017507|low-density 7176.CPIJ017507-PA XP_001867889.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]