SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ017762|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ017762|conserved
Domain Number 1 Region: 198-255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000113
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Domain Number 2 Region: 771-805
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000484
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 3 Region: 289-373
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000693
Family Spermadhesin, CUB domain 0.0078
Further Details:      
 
Weak hits

Sequence:  CPIJ017762|conserved
Domain Number - Region: 63-79,112-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0547
Family Spermadhesin, CUB domain 0.014
Further Details:      
 
Domain Number - Region: 478-540
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0563
Family Spermadhesin, CUB domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ017762|conserved
Sequence length 893
Comment hypothetical protein|protein_coding|supercont3.1030|58817|113338
Sequence
MQFNKACNRTLYGEVGRTYELQLQPHQVQQFQQEQQQHQHNGGAPLPFVCHLNFTAPGGA
YGDIVQLNFAKFSIGKFVAGTGGGGGGGAFPGGGGHHQQQPQHHRDLPQPQHEACLEGFM
TIREQGLPDLNGRWCGTASGYTIYYSETKSVNVTLRLDKLVQSGTGASSGAGPGGAPNES
PGGLQFRLIYKFLRHTDAKLRSWEQCDSEQDYLTIHDGKTLEAPMIGRICGGDALPDIVS
SGSDMTIQFRTSPYDVLFHPNPVTFLPGFELEVHILYVNSNSQSYIRQPGRCEFSISAFE
SQTGELESPQHTLPPESSCIYHFQGRRHETVWISFVKYHSAIDPTGFESPAECVNQLRIW
DGRWSVSSRPYGSHPEYSRNASLIEQICREEVPRLCSRSLVAKGSRPCSTQESYLSTGSD
LTIEYRPSPIGTARLYGPASAFKLRYEFVDNSLGGAPLEPLVAPSAMPEPAALVQFHPKS
CDRVFRSSSASRGIFRSPSNVFLYGRGGSPNISCTIRFEAGLGESVRLSITRARFGGRSC
QNMQNRSGRWHCNHHSGPISDLRISEVPWTDIPPLPRDCLCSDVSASINLAPLAASIVEV
RFTAMQMEVDQDFRDFYFEGRYEFEKDGCETDWSDRRLRGRSGDAFLKPTPCPALIQPWL
LEPETEGSYLVLKMKGFWMPPLLHSAPPCPTDARITVYSTNNPKNSRDLCPSGPDVVAFS
DGWDNAYEFSALEISKNLIIEFKSSRKPRDIEGNEYKFSWMEIYPGNDCPYKCQELQACI
PAELWCDGKVHCPSGQDESPTECNIRLPLSPLHVGIAAATLTLFLSLAAGLTACARRKRV
EKKHQHLQSSHHLEANGHYPHHGSYPHVAPHHHMASSHALTPIYLDPTKDSFC
Download sequence
Identical sequences B0XEK8
7176.CPIJ017762-PA CPIJ017762|conserved XP_001868080.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]