SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ018132|predicted from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ018132|predicted
Domain Number 1 Region: 98-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ018132|predicted
Sequence length 356
Comment protein|protein_coding|supercont3.1160|7938|80759
Sequence
MDEWKYLIALLLALLSFRLPAVDSTSGTSNGGSPSSGGTSTRTARERSGGQAIASLSSAS
IAALQAARNSNNAALAAAAAASATTVTASSAVGGVGGQRCSLAQFRCANGTCISAAKYCD
GIVDCLDKSDEPKLCTACNRTLYGEVGRTYELQLQPHQVQQFQQEQQQHQHNGGAPLPFV
CHLNFTAPGGAYGDIVQLNFAKFSIGKFVAGTGEGGGGGAFPGGGGHHQQQPQHHRDLPQ
PQHEACLEGFMTIREQGLPDLNGRWCGTASGYTIYYSETKSVNVTLRLDKLVQTGTGASS
GAGPGGAPNESPGGLQFRLIYKFLRHTDAKLRNDNRIWNGDLVAGTYCNRNFYDCD
Download sequence
Identical sequences A0A1S4KCR2
CPIJ018132|predicted 7176.CPIJ018132-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]