SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ018281|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CPIJ018281|conserved
Domain Number - Region: 63-124
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000109
Family Spermadhesin, CUB domain 0.012
Further Details:      
 
Domain Number - Region: 441-466
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00157
Family LDL receptor-like module 0.0044
Further Details:      
 
Domain Number - Region: 204-263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00733
Family Spermadhesin, CUB domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ018281|conserved
Sequence length 566
Comment hypothetical protein|protein_coding|supercont3.1164|12464|17785
Sequence
MKGSLQSGFFGLQQGNTTAYLIFATNAAVGADRTESLGLVPELVRDFRINRIEAPIIRHE
EDCAESLTIYDANHPDPARIIKTFCDTFSRPMEKIDFVSTGRSLYVKFLSKTGSYSGSSL
YYWAHYDFFNNSRYGDVVQNTLCDEVFYAWKYSKGQLGSPRNTLIYKRASGSDVRCQYKF
VTDRRLFSRVVVEVTSVTFKEVPYSMNACTRCHEERVDKLILWEEKDKNQNRLACFCDNI
PRPVRVISSGDQMNLELIIQGQHATTSYFKNPHTLFEANYEFAHGPICGPISLGPSPDGE
LVFPYKNALGIQLNENRREKCIWELKVAAQRDLWLHLDKARFADRSCEHGRIEVYLAGRL
EPRFIICPENVSLARDLPILSAAELGAVENENEPLPVLIQYTGDSAVGKNAFKFVWTELF
HLPRNADGTLATSSMFKDSCDFYCPGDQHVCIPEYLLCNGVHNCPNVTGLRVVESNIDKN
YEYIEENYIRTGLFDKDFLLNIPYLTDEAPELCRTKYIPSNGDFPDVVECFQFPVVQMVV
AGVVLATLIILAFTIYCRLYGQKHYD
Download sequence
Identical sequences B0XFZ9
7176.CPIJ018281-PA XP_001868571.1.94360 CPIJ018281|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]