SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ019761|leukocyte from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ019761|leukocyte
Domain Number 1 Region: 818-1066
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.76e-56
Family Protein kinases, catalytic subunit 0.00000313
Further Details:      
 
Domain Number 2 Region: 148-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-27
Family MAM domain 0.029
Further Details:      
 
Weak hits

Sequence:  CPIJ019761|leukocyte
Domain Number - Region: 102-140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00209
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number - Region: 2-95
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00269
Family MAM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ019761|leukocyte
Sequence length 1353
Comment receptor tyrosine protein kinase|protein_coding|supercont3.2218|22444|34418
Sequence
MFGATRENCYLEVYTHQSMMAYGSLRIVIETVGSHESSWVPAEVMGNDLGKWLLNKFRID
KITKDFRILFEVVPNRLGEHPRGHVSIDNLRMVNCFPDAISTNNCSFSQVRCTASKVPVC
IKTPKICDIEKDCDDEEDETLNCDKIPFGGRCDFETGWCGWQNYGNAILSWARHSGPTPT
EKTGPDMDHTHEATMENVTGYYMFVNMNQHANDSEKKTLVGLASNAIMNSVIFNPPPLVH
TNASSPYRNSCVVRFYVHQFGMNPGSINLSSVEIKEKENVTTTLWWSSKNLGEYWVRVDI
ILPNITTKYYLQFEARMGMRIFSDVAIDDFSLSPECFGLNIPADDLQGYNYWDPRIGGVK
QPHKDFTGKSYLELNTCGAKGQHGPTPADCLTSYNGTEALNAVQVIDRQPFKGIQSWKVP
NEGYYTIIAKGAGGGLGSGGVGSSRGAMVLSVLELHKDEEIFILVGQSGEHACIKSMGYR
DETCEPKNKPPFAKDTLPMYTSKTQQVKNTVIEDGAGGGGGGTYVFLLNSANTAVPLLVA
GGGGGLGVGRYVDEDVQHGKKFIAGSKDVSGTAHSDHARHAGPGGGWRAQADMGLDPKYG
ASLLEGGRGGLPCYPPRGAHGQGGFGGGGGGCDTGGGGGGFSGGDTMINSTNGQGGGSFL
ASKRNVPELSMEQSGANSGHGAVLIIPAIQGCGCDYRCVALDEYRSMVGCICPDGWTLKP
DNFTACELQSETPEMQYLIVFFVVVVVILVAALASLILILYNRFQRKRQAALRHKMLLEQ
DLQLSRLRSTADDTGLTNFNPNYGCDGILNGNVDVKSLPQVARESLRLVKALGQGAFGEV
YQGLYRHRDGDAVEMPVAVYGTNRTISQERPSPLTMKDLIFCALDVAKGCRYMESKRFIH
RDIAARNCLLSSKGPGRVVKIADFGMARDIYRSDYYRKGGKAMLPIKWMPPEAFLDGIFT
SKTDVWSFGVLLWEVFSLGLMPYTGLPNRDVMQLVTGGGRLDAPPGCPNAIYRIMADCWN
PTPEDRPTFSNLLERLTTCTQDPEVMNAPLPSFFRPPSNERDTTIMRPPGNDDFCLQVPN
SSDYLIPLPGPRTVAERLLSEATGVTIPDTMVTCTPPKTASPRIINGQPQQDGKCWETSF
IREQPTVVTSMASMPAVQDPTMLVDKLISLDTPQQTPTSIQPPISFSTPMTNGPVTGHGH
NGVVVMAHCNGGINGSPQLLANGTGPNGSGIIPPPPLVDQIDTAKILNSIPPPPITLDPS
TLNKQQAGVGGTSYANIRMINASSLNGGDHGEKMAGGRGNGGGGGGGNGGGSNHHHSNSS
GSDKSGENRPTAFTIQTFSDRYINNENHSEISC
Download sequence
Identical sequences B0XKV4
CPIJ019761|leukocyte 7176.CPIJ019761-PA XP_001870276.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]