SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ019930|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ019930|conserved
Domain Number 1 Region: 70-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ019930|conserved
Sequence length 175
Comment hypothetical protein|protein_coding|supercont3.2044|8232|10758
Sequence
MRTVKPSHSLHALILPEVDHPPHEPATSNGHHEDQPPNVISPPDHPAAVSSGEEPLVDLA
SQKAASVAHSFRCQDGYFRCNSTVQCIAQRLNCDGIVHCDDGSDEQNCENTVANSFWDHF
FRKRPAAINDHLPFGPCAWNDTNSSCQCRATDVLCDYKGLTALPASWPMQNVTFL
Download sequence
Identical sequences B0XKI9
7176.CPIJ019930-PA XP_001870161.1.94360 CPIJ019930|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]