SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ020278|pro-epidermal from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ020278|pro-epidermal
Domain Number 1 Region: 270-508
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-46
Family YWTD domain 0.0000073
Further Details:      
 
Domain Number 2 Region: 60-98
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 221-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000035
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 4 Region: 101-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 147-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000419
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 192-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000587
Family EGF-type module 0.027
Further Details:      
 
Domain Number 7 Region: 19-55
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ020278|pro-epidermal
Sequence length 512
Comment growth factor|protein_coding|supercont3.2823|1290|2829
Sequence
MGHHNSVVVSFRLLCVPIDERGYRCKHDNGTCISASFLCDKHDDCPLGDDEENCENFEVP
HVPVPCSKFEFTCTDKMCIPKDLVCDGTRHCLDGSDETIGCMDVENKCKGFLCKNKHCVQ
SHDWVCDGVDDCGDGSDEENCFIGCTLEHGKFECADNSTCVDLKMVCDGKDDCGDRSDET
GLCTSRECDSMRCPEGCKNTPHGSVCLCKAGFVFDRKSKQCEDVNECERYGLCSQGCENT
PGSFRCTCASKFKLRKDGRTCEIADSTEALLLYTTQKSIGALYLTSKHQYYVAKNLSQVI
GVSYDGSYVYWTDISFKTEAIERSLEDGSKRELLLTSGLASPEDLALDWLTGNIYFSDSG
HMMIAVCSNNGQHCSSLIQDTLHKPRGIALLPQNGTMFYSDWGDKAMIGTAGMDGKNRRV
LIDENIHWPNGLSLDWPNGRLYWVDAKLKKIESVRLDGTQRTTVIGDVLKHPFAISVFND
RIYWSDWDTKSIQSCDKFSGKQRKTVVHDRQI
Download sequence
Identical sequences 7176.CPIJ020278-PA CPIJ020278|pro-epidermal

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]