SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ020279|low-density from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ020279|low-density
Domain Number 1 Region: 22-59
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000089
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 109-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 63-99
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ020279|low-density
Sequence length 260
Comment lipoprotein receptor|protein_coding|supercont3.2823|5458|6643
Sequence
MLRLFTFAFLVIWVRCHPAFDNPSCTVDQFRCDSGHCTPLVGRCNGVNDCPDGSDEYGCG
YLLCEEPEWFRCPDNRCINGALVCDGRRDCFGGEDEARCGIRFALRSGSCGKRQFACVNK
RCIPARQICDGVADCGDGSDETLGCLLLIPPSAIYRSRLNGSGIRPTTPRDDLWTVKDEA
KQKHVPCVSIAYQTGAPDGNGQSSRLTFGQIPTHTHTLLQQVRDPAKSPGARKVGCTGDK
VAAKMNGEDGLESFFRPLSV
Download sequence
Identical sequences B0XLQ0
XP_001870572.1.94360 7176.CPIJ020279-PA CPIJ020279|low-density

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]