SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ002151|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ002151|conserved
Domain Number 1 Region: 16-147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 137-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000406
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ002151|conserved
Sequence length 251
Comment hypothetical protein|protein_coding|supercont3.21|1314587|1319007
Sequence
MAPDRGRVYLVNNTSDINECAEYGEDVCEYGCSNTVGSFTCKCPKGLRVTDNNKCMDVNE
CLLRNGHGPCQDTCINTWSGYRCSCMGLPGTRLGDDGHSCEDIDECTVNNGGCSHTCLNT
LGRAFCVCPEGFMLDDDWKTCIDIDECLNQKSIRQEFRCQGSCINTVGSFRCLEEDELVS
DEDLGRIRDDGGFDDSRLLVVRPTGDDLNDDSDDTLCPTGYYFNTTMGDCQGLRQMCRRQ
VPAVYTEMAAR
Download sequence
Identical sequences B0W3Y5
CPIJ002151|conserved XP_001843419.1.94360 7176.CPIJ002151-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]