SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ003379|suppressorsof from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ003379|suppressorsof
Domain Number 1 Region: 17-57
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000249
Family SOCS box-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ003379|suppressorsof
Sequence length 145
Comment cytokine signalling|protein_coding|supercont3.44|826524|827060
Sequence
MFFEPMLTYPLNRNFTFSLQQLCRATIVSNTTYDGINGLPLPKSLKSYLKEYHYRQRIRI
RPLDEHLRRRTRSQRNRSGGHKDNYWAGLLEVDDNWPDLERRGMVGRDLGHLIAAAIAQE
REEREQARRVRTEKIVQKLFCCFRG
Download sequence
Identical sequences B0W7Z0
XP_001844824.1.94360 7176.CPIJ003379-PA CPIJ003379|suppressorsof

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]