SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ003545|rapsynoid|protein_coding|supercont3.48|1218171|1237114 from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ003545|rapsynoid|protein_coding|supercont3.48|1218171|1237114
Domain Number 1 Region: 456-667
Classification Level Classification E-value
Superfamily TPR-like 3.22e-37
Family Tetratricopeptide repeat (TPR) 0.0043
Further Details:      
 
Domain Number 2 Region: 860-1072
Classification Level Classification E-value
Superfamily TPR-like 3.41e-37
Family Tetratricopeptide repeat (TPR) 0.0079
Further Details:      
 
Domain Number 3 Region: 271-472
Classification Level Classification E-value
Superfamily TPR-like 1.31e-35
Family Tetratricopeptide repeat (TPR) 0.0054
Further Details:      
 
Domain Number 4 Region: 28-134
Classification Level Classification E-value
Superfamily TPR-like 3.16e-32
Family Tetratricopeptide repeat (TPR) 0.00045
Further Details:      
 
Domain Number 5 Region: 678-870
Classification Level Classification E-value
Superfamily TPR-like 1.64e-29
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number 6 Region: 154-299
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000106
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 7 Region: 1039-1163
Classification Level Classification E-value
Superfamily TPR-like 0.00000025
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ003545|rapsynoid|protein_coding|supercont3.48|1218171|1237114
Sequence length 2632
Sequence
MCCGANEPEGTPELPAANRALFLEKVRQSNTACQNGDFTTAVQLYTDALALDPSNHILFS
NRSAARLKQGQFALALQDATRARELCPQWPKAYFRQGVALQCLGRYGEALASFSSGLAQD
PNSKQLLAGLVEASIKSPLRHALEPTFQQLKAMKLDASPFVVISVVGQELLGAGQYHSAV
TVLESALRIGSCSLKLRGSVFSALSSAHWALNQLDKAIAYMQQDLAVAKSLGDTAGECRA
HGNLGSAYFSQGSYKEALTSHRYQLVLAMKCKDTQAAAAALTSLGHVYTAIGDYPNALAS
HKQCVQLVKQMGDRLQEAREIGNVGAVYLAMGEFDSAVDCHTQHLRLARKLGNQVEEARA
YSNLGSSYHYKRNFTQAITYHESVLRIAQQLGDRAIEARAYAGLGHAARCGHDFHQAKRW
HEKQLEMALAARDKVGEGRACSNLGIVYQLLGEHDAALKLHQAHLTIARQLQDKAGMGRA
YGNIGNAYSAAGFYEQAIKYHKQELVISKEVHDRSAEASTHGNLAVAYQALGAHDMALMH
YRAHLNIARELKDTAGEACALLNLGNCLSSRQEFAQAVPYYEQYLMLSQELGDVAAEGKA
CHFLGYAHYCIGNYREAVRYYDQDLALAKDLQNKMNMGRAYCNLGLAHLALGNTAGALEC
QKYFLAIAHMTNHLPGKFRALGNIGDVLIRMGDVDEAIKMYQRQLSLARQARERGMEAAA
CGALGLAHRLLKKFDKALGYHTQELTLRQEMGDLPGECRAHGHLGAVHMALTNYTHAVKC
YQEQLERAQELQDSAVEAQAFGNLGIARLNMGHYEDAIGYLEQQLGTLEQVNTPTAQHDR
ARALGHLGDCYDALGDYHAEAIKCHERHLALAVALQSPRDQERAYRGLGNCYKSVGNLQE
ALVCLEKRLVVSHELGNPEAKAAAYGDLGSIHSALGNYEQAINCLEHQRDIARELGDRAL
TSDAISGLGGVFQQMGDFDGSLRLHKQDLELCESINHAALQGRACGNLGSVYESLKNYTE
SVRYYEKQLSLTTDRLTKAHACLALGRVYHTMEQIPQAVSFLRQGLSIVQSLNKLEDESK
IRYRLGLSLLASGDEDNARQQMESAAQILESIRCDQVTPDGRTNLYNLQTSCYQTLQRIL
VNLGRNEEALVAAERCRSRMGADSNQSAENSLNNRKTLLTCSEYIFDTVNKSKTNIIYYS
LAGAELYAWFLSPQKRIVRFHVAKIDEQTLQMKKKPAIASATTTAAGGDKPEPDQPDSES
LLAQYIDFVRDALGVNSGSVLQEGDGSGWKSSNENLIDDFANERAGFLRMVNRNHLLNSS
NYSLSSLFSLGSVGGSVASLQGSTRSIGSLQGSTRSRRSNMLPPWQGPSCLHVLYNLLLA
PFEDLLPDISTTSRLGRRELILVLEKELYLVPFAILRSGDESGEYLSERCSLLTVPSLHT
LRQKSRTKAREPAEGLNSALVIGGPKIPASLSETWGWSESPASLQEAAMVSDMLNTKPLV
SCSATKEAIVSELGAAECVHFAANVSWKMGAVILSPGEVLDSQSQKRWDGDEDGVGDLGG
SEIPPLSDFVLSASDLLAMKLSAKLVVLSSYHSVEPITGSGVANLAGSWLFAGTGAILVS
LWPVPETAAKILLRAFYSALLQGTRAAKALAEAMQTVQHTKHFAHPANWAGFILIGGNVR
LSNKVALIGQALCELMRTPDKCRDALRVCLHLVEKSLQRIHRGQKNAMYTTQKSIEDKAG
PVIGWKDLLMAVGFRFEPAANGIPSSVFFPQTDPEDRLSQCSASLQALLGLSPTTLHALS
KLVNNAEIADEIIGVMRNVVTQFPPKGTTSNESESIDIIIGVRLWRVAGCHELLASLGFD
LMEVGQDQVTLRTGKQANRRNCQFVLQSLLALFDTQEAPKSLGIESSSSSESLNEDTSDE
AAPAAKPPSPTPTAPEAQRSVSPAVTVKSQASYNFPRPPLPFRRVPFLSTRSAFISYVRR
RGEPDGGQTEVPMGTQQAQAQQDSSLANTTDSELSDGYTTQQILMKSDHLAKGLGYSSLR
GTIKVSRPGGGGESDAAFTPSPPVTLQTVVDPNVSLALAHQTRIRNLYTNNGVSSYGHET
VREGGVNMRRPDSSSSASSATDWEGSGHATVLRRANQGHPNLPPLPPPRQTLPMVDSLRP
LAPLAPVYNNITGGSGSTVGKVPQTKSVLESTSSDSEFERSFDLPSGSNAGSISSKLTSL
AHSIQSMRSRKMKLQPMQQQQQQQLQQTKKMVDQFSFMDRLSCRTEISSSSNHHVAPPRK
PLSTLPDDERTLNLNASKLYFNPADAEIIPLAESVTSAPTIGGPSSSTASSKDSNKPTNK
TIQDSIMRHMSREMTPTISEVYHERNIGLGLAPSLSKLLLSKNYDDSPDLKPQSSSSTSS
ASAAAAASLLNKPSAALTVGNLAEAMNEIEMNATTSSKLDVEGQCNICNSPSDLLCGCST
TSTVAAVAAMTAALGATTITKKSSSKPWLSNVTPNLVKPGDLTTADILEQQKQLKSTVSG
LTSNMSSSTENSLSTVVKRGGSPFSDLSRRDEGDGRSVADSQCSGSFRTDITGSTVTVTT
AAACKGGQQTTVSSGQAGSGMQQQSAQGGPGSSSGGSASGQTSSNFSRMLKT
Download sequence
Identical sequences B0W8X0
CPIJ003545|rapsynoid|protein_coding|supercont3.48|1218171|1237114 XP_001845185.1.94360 7176.CPIJ003545-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]