SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ004634|odorant-binding from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ004634|odorant-binding
Domain Number 1 Region: 78-219
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000000000143
Family Insect pheromone/odorant-binding proteins 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ004634|odorant-binding
Sequence length 242
Comment protein|protein_coding|supercont3.70|262125|262974
Sequence
MLKFVICLAFLGLVAAYDFKDSFYNELLLEDLLDSEDVLTSADRFRRSPAMADPADDKCK
KQHHKHKCCNDANTDNLDKIRDLKKQCFSEQKTKERSARGMIDPVDMFNCEKMNKTKQDL
ICAIECVGRKKSILDKDGNLLEATKLVPFVKENFAADPWQEPLVEGFVDTCLKEVAEKMA
AKTEEFRCNPASSHFGYCMWRQTTMACPKEKQEQSKKCEKIREKLANNEPITMFGKHDFD
DN
Download sequence
Identical sequences B0WBT5
XP_001846169.1.94360 CPIJ004634|odorant-binding 7176.CPIJ004634-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]