SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ005298|SP555|protein_coding|supercont3.83|251913|252495 from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ005298|SP555|protein_coding|supercont3.83|251913|252495
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-25
Family SPRY domain 0.0041
Further Details:      
 
Domain Number 2 Region: 114-149
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000471
Family SOCS box-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ005298|SP555|protein_coding|supercont3.83|251913|252495
Sequence length 171
Sequence
MMFGIGTKKARLHVNAFTNLLGEDKNGWGLSHKGLLWHGGIARNYTKRFKENQATRIGIL
FDGVAGTLTYYKDDVCLGIAFRGLNEIREPLYPVVCSTAAKTEMVLTESRRDFVNLQDRC
RAVIIKHIKTREKLDRLNLPYCITNYLAEALSDCTTPVTPLEQQLIDYYLF
Download sequence
Identical sequences B0WDA8
CPIJ005298|SP555|protein_coding|supercont3.83|251913|252495 XP_001846676.1.94360 7176.CPIJ005298-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]